StarFunc result for job id Q9NWS0

User Input

>input (290 residues)
MANPKLLGMGLSEAEAIGADSARFEELLLQASKELQQAQTTRPESTQIQPQPGFCIKTNS
SEGKVFINICHSPSIPPPADVTEEELLQMLEEDQAGFRIPMSLGEPHAELDAKGQGCTAY
DVAVNSDFYRRMQNSDFLRELVITIAREGLEDKYNLQLNPEWRMMKNRPFMGSISQQNIR
SEQRPRIQELGDLYTPAPGRAESGPEKPHLNLWLEAPDLLLAEVDLPKLDGALGLSLEIG
ENRLVMGGPQQLYHLDAYIPLQINSHESKAAFHRKRKQLMVAMPLLPVPS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9NWS0	1.000	1.000	1.663E-55	290	1.000	1.000	Q9NWS0.pdb.gz	PIHD1_HUMAN PIH1 domain-containing protein 1 OS=Homo sapiens OX=9606 GN=PIH1D1 PE=1 SV=1
2	AFDB:Q9CQJ2	0.514	0.514	4.663E-47	290	0.803	0.803	Q9CQJ2.pdb.gz	PIHD1_MOUSE PIH1 domain-containing protein 1 OS=Mus musculus OX=10090 GN=Pih1d1 PE=1 SV=1
3	AFDB:Q1RM55	0.529	0.534	6.018E-32	287	0.383	0.387	Q1RM55.pdb.gz	PIHD1_DANRE PIH1 domain-containing protein 1 OS=Danio rerio OX=7955 GN=pih1d1 PE=2 SV=2
4	AFDB:B6F1W5	0.391	0.198	4.040E-20	588	0.228	0.112	B6F1W5.pdb.gz	KTU_ORYLA Protein kintoun OS=Oryzias latipes OX=8090 GN=dnaaf2 PE=2 SV=1
5	AFDB:Q0E9G3	0.413	0.150	1.209E-19	834	0.231	0.080	Q0E9G3.pdb.gz	KTU_DROME Protein kintoun OS=Drosophila melanogaster OX=7227 GN=Nop17l PE=1 SV=1
6	AFDB:B1H1W9	0.409	0.158	2.750E-19	788	0.217	0.080	B1H1W9.pdb.gz	KTU_XENLA Protein kintoun OS=Xenopus laevis OX=8355 GN=dnaaf2 PE=2 SV=1
7	AFDB:Q38DW7	0.413	0.210	4.035E-19	585	0.262	0.130	Q38DW7.pdb.gz	Q38DW7_TRYB2 PIH1 N-terminal domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.211.1870 PE=3 SV=1
8	AFDB:D4AHU0	0.449	0.300	5.024E-19	451	0.248	0.160	D4AHU0.pdb.gz	D4AHU0_CHLRE MOT48 protein OS=Chlamydomonas reinhardtii OX=3055 GN=MOT48 PE=2 SV=1
9	AFDB:Q9NVR5	0.391	0.142	5.307E-19	837	0.210	0.073	Q9NVR5.pdb.gz	KTU_HUMAN Protein kintoun OS=Homo sapiens OX=9606 GN=DNAAF2 PE=1 SV=2
10	AFDB:Q499A3	0.405	0.212	5.921E-19	566	0.255	0.131	Q499A3.pdb.gz	KTU_DANRE Protein kintoun OS=Danio rerio OX=7955 GN=dnaaf2 PE=2 SV=1
11	PDB:3w1zB	0.246	0.479	4.624E-5	143	0.059	0.119	3w1zB.pdb.gz
12	PDB:4ylbA	0.253	0.546	6.074E-4	128	0.045	0.102	4ylbA.pdb.gz
13	PDB:7krjC	0.222	0.442	7.563E-4	133	0.038	0.083	7krjC.pdb.gz	Structure of Hsp90-p23-GR reveals the Hsp90 client-remodelling mechanism.
14	PDB:1gmeA	0.232	0.427	8.914E-4	150	0.059	0.113	1gmeA.pdb.gz
15	PDB:6f2rA	0.224	0.461	2.667E-3	130	0.059	0.131	6f2rA.pdb.gz	Terminal Regions Confer Plasticity to the Tetrameric Assembly of Human HspB2 and HspB3.
16	PDB:4zjaA	0.214	0.533	3.507E-3	106	0.055	0.151	4zjaA.pdb.gz
17	PDB:1shsA	0.232	0.558	9.404E-3	115	0.045	0.113	1shsA.pdb.gz
18	PDB:5ltwL	0.208	0.551	3.139E-2	100	0.045	0.130	5ltwL.pdb.gz
19	PDB:4ydzA	0.211	0.424	4.361E-2	135	0.028	0.059	4ydzA.pdb.gz
20	PDB:6f2rQ	0.187	0.552	9.921E-2	89	0.031	0.101	6f2rQ.pdb.gz	Terminal Regions Confer Plasticity to the Tetrameric Assembly of Human HspB2 and HspB3.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9NWS0	0.0	594	290	1.000	1.000	PIHD1_HUMAN PIH1 domain-containing protein 1 OS=Homo sapiens OX=9606 GN=PIH1D1 PE=1 SV=1
2	Q9CQJ2	1.52e-174	485	290	0.803	0.803	PIHD1_MOUSE PIH1 domain-containing protein 1 OS=Mus musculus OX=10090 GN=Pih1d1 PE=1 SV=1
3	Q1RM55	9.50e-70	219	287	0.379	0.383	PIHD1_DANRE PIH1 domain-containing protein 1 OS=Danio rerio OX=7955 GN=pih1d1 PE=2 SV=2
4	Q38DW7	7.57e-18	85.5	585	0.203	0.101	Q38DW7_TRYB2 PIH1 N-terminal domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.211.1870 PE=3 SV=1
5	D4AHU0	1.90e-14	75.1	451	0.155	0.100	D4AHU0_CHLRE MOT48 protein OS=Chlamydomonas reinhardtii OX=3055 GN=MOT48 PE=2 SV=1
6	P38768	1.63e-09	60.1	344	0.128	0.108	PIH1_YEAST Protein interacting with Hsp90 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PIH1 PE=1 SV=1
7	Q0E9G3	1.33e-07	55.1	834	0.214	0.074	KTU_DROME Protein kintoun OS=Drosophila melanogaster OX=7227 GN=Nop17l PE=1 SV=1
8	Q8WWB5	1.70e-06	50.8	315	0.203	0.187	PIHD2_HUMAN PIH1 domain-containing protein 2 OS=Homo sapiens OX=9606 GN=PIH1D2 PE=1 SV=1
9	B6F1W5	1.72e-06	51.2	588	0.207	0.102	KTU_ORYLA Protein kintoun OS=Oryzias latipes OX=8090 GN=dnaaf2 PE=2 SV=1
10	Q499A3	8.68e-06	49.3	566	0.124	0.064	KTU_DANRE Protein kintoun OS=Danio rerio OX=7955 GN=dnaaf2 PE=2 SV=1
11	Q9NVR5	2.10e-04	45.1	837	0.197	0.068	KTU_HUMAN Protein kintoun OS=Homo sapiens OX=9606 GN=DNAAF2 PE=1 SV=2
12	Q5PRB3	0.092	36.2	322	0.124	0.112	PIHD2_DANRE PIH1 domain-containing protein 2 OS=Danio rerio OX=7955 GN=pih1d2 PE=2 SV=1
13	Q8BPI1	0.74	33.9	814	0.062	0.022	KTU_MOUSE Protein kintoun OS=Mus musculus OX=10090 GN=Dnaaf2 PE=1 SV=2
14	B5BUZ8	0.91	33.5	675	0.069	0.030	KTU_CHLRE Protein kintoun OS=Chlamydomonas reinhardtii OX=3055 GN=pf13 PE=2 SV=1
15	Q9DGB8	2.8	32.0	451	0.117	0.075	Q9DGB8_DANRE Runt-related transcription factor OS=Danio rerio OX=7955 GN=runxa PE=2 SV=1
16	Q6P9S7	7.5	30.8	603	0.048	0.023	GLT10_MOUSE Polypeptide N-acetylgalactosaminyltransferase 10 OS=Mus musculus OX=10090 GN=Galnt10 PE=2 SV=1
17	C0SVZ6	9.3	30.0	389	0.148	0.111	CURS1_CURLO Curcumin synthase 1 OS=Curcuma longa OX=136217 GN=CURS1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF19751 DUF6238	4.1e+02	12.3	Family of unknown function (DUF6238)
2	PF08190 PIH1	9.5e-33	124.5	PIH1 N-terminal domain
3	PF18201 PIH1_CS	6e-05	34.7	PIH1 CS-like domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000262265

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000005386	0.999	RNA polymerase II-associated protein 3
2	9606.ENSP00000318297	0.999	RuvB-like 1
3	9606.ENSP00000473172	0.999	RuvB-like 2
4	9606.ENSP00000264279	0.993	Nucleolar protein 58
5	9606.ENSP00000368459	0.968	Nuclear fragile X mental retardation-interacting protein 1
6	9606.ENSP00000295121	0.953	Uncharacterized protein DKFZp434B156
7	9606.ENSP00000376097	0.933	Unconventional prefoldin RPB5 interactor 1
8	9606.ENSP00000370589	0.927	Nucleolar protein 56
9	9606.ENSP00000359606	0.923	Box C/D snoRNA protein 1
10	9606.ENSP00000476948	0.922	Putative RNA polymerase II subunit B1 CTD phosphatase RPAP2
11	9606.ENSP00000337393	0.904	Protein UXT
12	9606.ENSP00000335153	0.903	Heat shock protein HSP 90-alpha
13	9606.ENSP00000362547	0.891	TELO2-interacting protein 1 homolog
14	9606.ENSP00000442770	0.891	GPN-loop GTPase 3
15	9606.ENSP00000484687	0.886	Zinc finger HIT-type containing 3
16	9606.ENSP00000482075	0.885	Prostaglandin E synthase 3
17	9606.ENSP00000219252	0.883	DNA-directed RNA polymerase II subunit RPB3
18	9606.ENSP00000262319	0.882	Telomere length regulation protein TEL2 homolog
19	9606.ENSP00000478303	0.882	DNA-directed RNA polymerases I, II, and III subunit RPABC1
20	9606.ENSP00000202017	0.878	P53 and DNA damage-regulated protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:1901363	0.985	heterocyclic compound binding
GO:0097159	0.985	organic cyclic compound binding
GO:0003676	0.984	nucleic acid binding
GO:0019899	0.983	enzyme binding
GO:0001046	0.910	core promoter sequence-specific DNA binding
GO:0051219	0.909	phosphoprotein binding
GO:0019900	0.896	kinase binding
GO:0019901	0.892	protein kinase binding
GO:0001163	0.803	RNA polymerase I transcription regulatory region sequence-specific DNA binding
GO:0051117	0.792	ATPase binding
GO:0001164	0.792	RNA polymerase I core promoter sequence-specific DNA binding
GO:0042393	0.727	histone binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0050789	0.991	regulation of biological process
GO:0016043	0.987	cellular component organization
GO:0044085	0.985	cellular component biogenesis
GO:0065003	0.978	protein-containing complex assembly
GO:0050794	0.977	regulation of cellular process
GO:0060255	0.953	regulation of macromolecule metabolic process
GO:0051171	0.949	regulation of nitrogen compound metabolic process
GO:0080090	0.947	regulation of primary metabolic process
GO:0031323	0.929	regulation of cellular metabolic process
GO:0048518	0.926	positive regulation of biological process
GO:0048522	0.914	positive regulation of cellular process
GO:0010468	0.836	regulation of gene expression
GO:0019219	0.822	regulation of nucleobase-containing compound metabolic process
GO:0009893	0.817	positive regulation of metabolic process
GO:0010604	0.795	positive regulation of macromolecule metabolic process
GO:0051173	0.702	positive regulation of nitrogen compound metabolic process
GO:0031325	0.699	positive regulation of cellular metabolic process
GO:0048583	0.690	regulation of response to stimulus
GO:0010556	0.682	regulation of macromolecule biosynthetic process
GO:0031326	0.682	regulation of cellular biosynthetic process
GO:0051252	0.677	regulation of RNA metabolic process
GO:0051179	0.665	localization
GO:0048519	0.656	negative regulation of biological process
GO:0048523	0.588	negative regulation of cellular process
GO:0022613	0.549	ribonucleoprotein complex biogenesis
GO:0031401	0.533	positive regulation of protein modification process
GO:0050790	0.527	regulation of catalytic activity
GO:0051174	0.523	regulation of phosphorus metabolic process
GO:0019220	0.511	regulation of phosphate metabolic process
GO:0042325	0.501	regulation of phosphorylation
GO:0009966	0.500	regulation of signal transduction
GO:0022618	0.496	ribonucleoprotein complex assembly
GO:0045935	0.493	positive regulation of nucleobase-containing compound metabolic process
GO:0031328	0.492	positive regulation of cellular biosynthetic process
GO:0010557	0.490	positive regulation of macromolecule biosynthetic process
GO:0051172	0.487	negative regulation of nitrogen compound metabolic process
GO:0051338	0.483	regulation of transferase activity
GO:0043085	0.478	positive regulation of catalytic activity
GO:0010605	0.477	negative regulation of macromolecule metabolic process
GO:0033036	0.469	macromolecule localization
GO:1902531	0.462	regulation of intracellular signal transduction
GO:0006355	0.455	regulation of DNA-templated transcription
GO:0048584	0.445	positive regulation of response to stimulus
GO:0008104	0.445	protein localization
GO:0031324	0.444	negative regulation of cellular metabolic process
GO:0048585	0.441	negative regulation of response to stimulus
GO:0051248	0.441	negative regulation of protein metabolic process
GO:0043086	0.440	negative regulation of catalytic activity
GO:1902680	0.440	positive regulation of RNA biosynthetic process
GO:2000756	0.438	regulation of peptidyl-lysine acetylation
GO:0045893	0.431	positive regulation of DNA-templated transcription
GO:0051128	0.429	regulation of cellular component organization
GO:0031056	0.425	regulation of histone modification
GO:0051336	0.415	regulation of hydrolase activity
GO:0031400	0.413	negative regulation of protein modification process
GO:0045937	0.406	positive regulation of phosphate metabolic process
GO:0001934	0.400	positive regulation of protein phosphorylation
GO:0031058	0.399	positive regulation of histone modification
GO:0033674	0.399	positive regulation of kinase activity
GO:0034502	0.397	protein localization to chromosome
GO:0045859	0.397	regulation of protein kinase activity
GO:0044087	0.396	regulation of cellular component biogenesis
GO:0043066	0.396	negative regulation of apoptotic process
GO:0010466	0.396	negative regulation of peptidase activity
GO:1901985	0.395	positive regulation of protein acetylation
GO:0035065	0.394	regulation of histone acetylation
GO:0031057	0.392	negative regulation of histone modification
GO:2000117	0.390	negative regulation of cysteine-type endopeptidase activity
GO:2001233	0.388	regulation of apoptotic signaling pathway
GO:0009968	0.386	negative regulation of signal transduction
GO:0032502	0.384	developmental process
GO:0043254	0.384	regulation of protein-containing complex assembly
GO:1902533	0.384	positive regulation of intracellular signal transduction
GO:0051130	0.379	positive regulation of cellular component organization
GO:1904263	0.369	positive regulation of TORC1 signaling
GO:0071168	0.356	protein localization to chromatin
GO:0140747	0.353	regulation of ncRNA transcription
GO:2000758	0.348	positive regulation of peptidyl-lysine acetylation
GO:2001234	0.344	negative regulation of apoptotic signaling pathway
GO:1901984	0.340	negative regulation of protein acetylation
GO:0045184	0.338	establishment of protein localization
GO:0009888	0.331	tissue development
GO:0071900	0.328	regulation of protein serine/threonine kinase activity
GO:0071704	0.327	organic substance metabolic process
GO:0072594	0.314	establishment of protein localization to organelle
GO:0071902	0.313	positive regulation of protein serine/threonine kinase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032991	1.000	protein-containing complex
GO:0031981	0.995	nuclear lumen
GO:0043232	0.985	intracellular non-membrane-bounded organelle
GO:0005737	0.976	cytoplasm
GO:0005829	0.966	cytosol
GO:0005654	0.957	nucleoplasm
GO:0005730	0.720	nucleolus
GO:1990904	0.698	ribonucleoprotein complex
GO:0140535	0.585	intracellular protein-containing complex
GO:0097255	0.437	R2TP complex
GO:0070761	0.363	pre-snoRNP complex
GO:1990062	0.356	RPAP3/R2TP/prefoldin-like complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]