StarFunc result for job id Q9NWU1

User Input

>input (459 residues)
MSNCLQNFLKITSTRLLCSRLCQQLRSKRKFFGTVPISRLHRRVVITGIGLVTPLGVGTH
LVWDRLIGGESGIVSLVGEEYKSIPCSVAAYVPRGSDEGQFNEQNFVSKSDIKSMSSPTI
MAIGAAELAMKDSGWHPQSEADQVATGVAIGMGMIPLEVVSETALNFQTKGYNKVSPFFV
PKILVNMAAGQVSIRYKLKGPNHAVSTACTTGAHAVGDSFRFIAHGDADVMVAGGTDSCI
SPLSLAGFSRARALSTNSDPKLACRPFHPKRDGFVMGEGAAVLVLEEYEHAVQRRARIYA
EVLGYGLSGDAGHITAPDPEGEGALRCMAAALKDAGVQPEEISYINAHATSTPLGDAAEN
KAIKHLFKDHAYALAVSSTKGATGHLLGAAGAVEAAFTTLACYYQKLPPTLNLDCSEPEF
DLNYVPLKAQEWKTEKRFIGLTNSFGFGGTNATLCIAGL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9NWU1	1.000	1.000	0.000	459	1.000	1.000	Q9NWU1.pdb.gz	OXSM_HUMAN 3-oxoacyl-[acyl-carrier-protein] synthase, mitochondrial OS=Homo sapiens OX=9606 GN=OXSM PE=1 SV=1
2	AFDB:Q9D404	0.934	0.934	3.255E-96	459	0.830	0.830	Q9D404.pdb.gz	OXSM_MOUSE 3-oxoacyl-[acyl-carrier-protein] synthase, mitochondrial OS=Mus musculus OX=10090 GN=Oxsm PE=1 SV=1
3	PDB:2c9hA	0.923	0.992	5.911E-95	427	0.917	0.986	2c9hA.pdb.gz
4	AFDB:Q8L3X9	0.893	0.889	9.269E-64	461	0.488	0.486	Q8L3X9.pdb.gz	KASM_ARATH 3-oxoacyl-[acyl-carrier-protein] synthase, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=KAS PE=1 SV=1
5	PDB:2ix4A	0.874	0.930	1.391E-62	431	0.481	0.513	2ix4A.pdb.gz	Structure of the Human Beta-Ketoacyl [Acp] Synthase from the Mitochondrial Type II Fatty Acid Synthase.
6	AFDB:O94297	0.890	0.958	1.072E-60	426	0.453	0.488	O94297.pdb.gz	OXSM_SCHPO Putative 3-oxoacyl-[acyl-carrier-protein] synthase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC887.13c PE=3 SV=1
7	AFDB:P0AAI5	0.880	0.976	1.872E-59	413	0.414	0.460	P0AAI5.pdb.gz	FABF_ECOLI 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Escherichia coli (strain K12) OX=83333 GN=fabF PE=1 SV=2
8	PDB:7l4lA	0.875	0.973	2.636E-58	412	0.416	0.464	7l4lA.pdb.gz	Structure and Mechanistic Analyses of the Gating Mechanism of Elongating Ketosynthases
9	AFDB:Q72CS9	0.869	0.959	1.076E-56	415	0.366	0.405	Q72CS9.pdb.gz	Q72CS9_DESVH 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Desulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / NCIMB 8303 / VKM B-1760 / Hildenborough) OX=882 GN=fabF PE=1 SV=1
10	AFDB:C6KT99	0.871	0.846	5.896E-55	473	0.346	0.336	C6KT99.pdb.gz	C6KT99_PLAF7 beta-ketoacyl-[acyl-carrier-protein] synthase I OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0626300 PE=3 SV=1
11	AFDB:Q9C9P4	0.862	0.734	9.514E-53	541	0.362	0.307	Q9C9P4.pdb.gz	KASC2_ARATH 3-oxoacyl-[acyl-carrier-protein] synthase II, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=KAS2 PE=1 SV=1
12	AFDB:F4KHF4	0.854	0.803	3.182E-52	489	0.359	0.337	F4KHF4.pdb.gz	F4KHF4_ARATH beta-ketoacyl-[acyl-carrier-protein] synthase I OS=Arabidopsis thaliana OX=3702 GN=KASI PE=1 SV=1
13	AFDB:P39525	0.837	0.868	4.818E-50	442	0.375	0.389	P39525.pdb.gz	CEM1_YEAST 3-oxoacyl-[acyl-carrier-protein] synthase homolog OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CEM1 PE=1 SV=1
14	PDB:2wgeA	0.836	0.922	1.207E-44	415	0.309	0.342	2wgeA.pdb.gz	Crystal Structures of Mycobacterium Tuberculosis Kasa Show Mode of Action within Cell Wall Biosynthesis and its Inhibition by Thiolactomycin
15	PDB:5kofA	0.833	0.936	1.350E-43	407	0.305	0.344	5kofA.pdb.gz	Molecular basis for interactions between an acyl carrier protein and a ketosynthase.
16	PDB:2gp6A	0.839	0.925	1.417E-42	415	0.305	0.337	2gp6A.pdb.gz
17	PDB:7cpxA	0.799	0.171	1.243E-29	2262	0.207	0.042	7cpxA.pdb.gz	Structural basis for the biosynthesis of lovastatin.
18	PDB:2vz9B	0.775	0.180	4.300E-27	2086	0.218	0.048	2vz9B.pdb.gz	The Crystal Structure of a Mammalian Fatty Acid Synthase.
19	PDB:2vz8A	0.774	0.191	5.203E-27	1962	0.218	0.051	2vz8A.pdb.gz
20	PDB:2vz8B	0.775	0.187	1.115E-26	2004	0.218	0.050	2vz8B.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9D404	0.0	809	459	0.850	0.850	OXSM_MOUSE 3-oxoacyl-[acyl-carrier-protein] synthase, mitochondrial OS=Mus musculus OX=10090 GN=Oxsm PE=1 SV=1
2	Q9NWU1	0.0	951	459	1.000	1.000	OXSM_HUMAN 3-oxoacyl-[acyl-carrier-protein] synthase, mitochondrial OS=Homo sapiens OX=9606 GN=OXSM PE=1 SV=1
3	Q8L3X9	3.14e-139	409	461	0.503	0.501	KASM_ARATH 3-oxoacyl-[acyl-carrier-protein] synthase, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=KAS PE=1 SV=1
4	O94297	5.86e-135	397	426	0.455	0.491	OXSM_SCHPO Putative 3-oxoacyl-[acyl-carrier-protein] synthase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC887.13c PE=3 SV=1
5	P0AAI5	4.18e-107	325	413	0.412	0.458	FABF_ECOLI 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Escherichia coli (strain K12) OX=83333 GN=fabF PE=1 SV=2
6	Q72CS9	3.34e-96	297	415	0.368	0.407	Q72CS9_DESVH 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Desulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / NCIMB 8303 / VKM B-1760 / Hildenborough) OX=882 GN=fabF PE=1 SV=1
7	P39525	1.03e-95	297	442	0.386	0.400	CEM1_YEAST 3-oxoacyl-[acyl-carrier-protein] synthase homolog OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CEM1 PE=1 SV=1
8	C6KT99	5.64e-94	293	473	0.333	0.323	C6KT99_PLAF7 beta-ketoacyl-[acyl-carrier-protein] synthase I OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0626300 PE=3 SV=1
9	F4KHF4	1.50e-86	275	489	0.368	0.346	F4KHF4_ARATH beta-ketoacyl-[acyl-carrier-protein] synthase I OS=Arabidopsis thaliana OX=3702 GN=KASI PE=1 SV=1
10	Q586W9	9.42e-80	258	500	0.414	0.380	Q586W9_TRYB2 beta-ketoacyl-[acyl-carrier-protein] synthase I OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=28H13.305 PE=3 SV=1
11	Q9C9P4	4.03e-79	257	541	0.368	0.312	KASC2_ARATH 3-oxoacyl-[acyl-carrier-protein] synthase II, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=KAS2 PE=1 SV=1
12	P9WQD7	2.13e-67	223	417	0.316	0.348	KASB_MYCTU 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=kasB PE=1 SV=1
13	P9WQD9	6.42e-64	214	416	0.316	0.349	KASA_MYCTU 3-oxoacyl-[acyl-carrier-protein] synthase 1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=kasA PE=1 SV=1
14	P0A953	5.69e-62	208	406	0.312	0.352	FABB_ECOLI 3-oxoacyl-[acyl-carrier-protein] synthase 1 OS=Escherichia coli (strain K12) OX=83333 GN=fabB PE=1 SV=1
15	Q9I3B2	4.45e-60	203	405	0.320	0.363	Q9I3B2_PSEAE Beta-ketoacyl-ACP synthase I OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=fabB PE=3 SV=1
16	Q6DNE3	5.34e-33	135	2298	0.261	0.052	Q6DNE3_9CYAN CurJ OS=Lyngbya majuscula OX=158786 GN=curJ PE=1 SV=1
17	Q7TXM0	5.46e-33	135	1876	0.268	0.066	PPSA_MYCBO Phenolphthiocerol/phthiocerol polyketide synthase subunit A OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) OX=233413 GN=ppsA PE=1 SV=1
18	P9WQE7	6.16e-33	135	1876	0.268	0.066	PPSA_MYCTU Phenolphthiocerol/phthiocerol polyketide synthase subunit A OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=ppsA PE=1 SV=1
19	F1DBA9	3.98e-31	129	2448	0.255	0.048	MPAC_PENBR Non-reducing polyketide synthase mapC OS=Penicillium brevicompactum OX=5074 GN=mpaC PE=1 SV=1
20	A0A0B5KU17	8.71e-31	128	2190	0.255	0.053	MPAC2_PENBR Non-reducing polyketide synthase mapC' OS=Penicillium brevicompactum OX=5074 GN=mpaC' PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF16197 KAsynt_C_assoc	1.2e+02	14.6	Ketoacyl-synthetase C-terminal extension
2	PF00109 ketoacyl-synt	2.2e-54	196.3	Beta-ketoacyl synthase, N-terminal domain
3	PF02801 Ketoacyl-synt_C	4.1e-34	128.5	Beta-ketoacyl synthase, C-terminal domain
4	PF00108 Thiolase_N	0.09	23.7	Thiolase, N-terminal domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000280701

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000458770	0.998	Acyl carrier protein, mitochondrial
2	9606.ENSP00000290429	0.992	Malonyl-CoA-acyl carrier protein transacylase, mitochondrial
3	9606.ENSP00000363794	0.981	Estradiol 17-beta-dehydrogenase 8
4	9606.ENSP00000303525	0.979	Carbonyl reductase family member 4
5	9606.ENSP00000263702	0.966	Enoyl-[acyl-carrier-protein] reductase, mitochondrial
6	9606.ENSP00000304592	0.937	Fatty acid synthase
7	9606.ENSP00000377115	0.883	Lipoyltransferase 1, mitochondrial
8	9606.ENSP00000378105	0.840	Elongation of very long chain fatty acids protein 6
9	9606.ENSP00000309463	0.832	Putative lipoyltransferase 2, mitochondrial
10	9606.ENSP00000292475	0.785	ATP synthase subunit f, mitochondrial
11	9606.ENSP00000379241	0.684	Leucine-rich repeat-containing protein 2
12	9606.ENSP00000430025	0.684	LYR motif containing 2
13	9606.ENSP00000341684	0.682	Coiled-coil domain containing 15
14	9606.ENSP00000438204	0.660	Mitochondrial import receptor subunit TOM5 homolog
15	9606.ENSP00000280700	0.654	Peptide-N(4)-(N-acetyl-beta-glucosaminyl)asparagine amidase
16	9606.ENSP00000365462	0.650	This is one of the 2 subunits of the biotin-dependent propionyl-CoA carboxylase (PCC), a mitochondrial enzyme involved in the catabolism of odd chain fatty acids, branched-chain amino acids isoleucine, threonine, methionine, and valine and other metabolites . Propionyl-CoA carboxylase catalyzes the carboxylation of propionyl-CoA/propanoyl-CoA to D-methylmalonyl- CoA/(S)-methylmalonyl-CoA (PubMed:8434582, PubMed:6765947, PubMed:10101253). Within the holoenzyme, the alpha subunit catalyzes the ATP-dependent carboxylation of the biotin carried by the biotin carboxyl carrier (BCC) domain, [...]
17	9606.ENSP00000473348	0.639	GDH/6PGL endoplasmic bifunctional protein
18	9606.ENSP00000409906	0.613	Inactive ubiquitin carboxyl-terminal hydrolase 53
19	9606.ENSP00000299432	0.608	Putative protein MSS51 homolog, mitochondrial
20	9606.ENSP00000264990	0.607	Acyl-CoA dehydrogenase family member 11

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004312	1.000	fatty acid synthase activity
GO:0005488	0.995	binding
GO:0005515	0.992	protein binding
GO:0004315	0.947	3-oxoacyl-[acyl-carrier-protein] synthase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.997	cellular process
GO:0071704	0.996	organic substance metabolic process
GO:0044238	0.993	primary metabolic process
GO:0009058	0.990	biosynthetic process
GO:0006807	0.986	nitrogen compound metabolic process
GO:0032787	0.986	monocarboxylic acid metabolic process
GO:0006631	0.982	fatty acid metabolic process
GO:1901360	0.981	organic cyclic compound metabolic process
GO:1901564	0.976	organonitrogen compound metabolic process
GO:0046483	0.976	heterocycle metabolic process
GO:0006725	0.971	cellular aromatic compound metabolic process
GO:1901576	0.970	organic substance biosynthetic process
GO:0034641	0.965	cellular nitrogen compound metabolic process
GO:0044249	0.957	cellular biosynthetic process
GO:0043603	0.943	amide metabolic process
GO:0009150	0.879	purine ribonucleotide metabolic process
GO:0006790	0.855	sulfur compound metabolic process
GO:0033875	0.816	ribonucleoside bisphosphate metabolic process
GO:0034032	0.816	purine nucleoside bisphosphate metabolic process
GO:0035383	0.815	thioester metabolic process
GO:0006637	0.814	acyl-CoA metabolic process
GO:0008610	0.716	lipid biosynthetic process
GO:0044283	0.599	small molecule biosynthetic process
GO:0046394	0.475	carboxylic acid biosynthetic process
GO:0072330	0.439	monocarboxylic acid biosynthetic process
GO:0006633	0.422	fatty acid biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	0.999	mitochondrion
GO:0005829	0.965	cytosol
GO:0070013	0.560	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:14993	1.000	acetyl-CoA + 2n H(+) + n malonyl-CoA + 2n NADPH = a long-chain fatty acid + n CO2 + (n+1) CoA + 2n NADP(+)
EC:2.3.1.85	1.000	fatty-acid synthase system.
RHEA:22836	0.947	a fatty acyl-[ACP] + H(+) + malonyl-[ACP] = a 3-oxoacyl-[ACP] + CO2 + holo-[ACP]
EC:2.3.1.41	0.947	beta-ketoacyl-[acyl-carrier-protein] synthase I.

[back to server]