StarFunc result for job id Q9NWV8

User Input

>input (329 residues)
MEVAEPSSPTEEEEEEEEHSAEPRPRTRSNPEGAEDRAVGAQASVGSRSEGEGEAASADD
GSLNTSGAGPKSWQVPPPAPEVQIRTPRVNCPEKVIICLDLSEEMSLPKLESFNGSKTNA
LNVSQKMIEMFVRTKHKIDKSHEFALVVVNDDTAWLSGLTSDPRELCSCLYDLETASCST
FNLEGLFSLIQQKTELPVTENVQTIPPPYVVRTILVYSRPPCQPQFSLTEPMKKMFQCPY
FFFDVVYIHNGTEEKEEEMSWKDMFAFMGSLDTKGTSYKYEVALAGPALELHNCMAKLLA
HPLQRPCQSHASYSLLEEEDEAIEVEATV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q3UI43	0.874	0.863	1.080E-57	333	0.909	0.898	Q3UI43.pdb.gz	BABA1_MOUSE BRISC and BRCA1-A complex member 1 OS=Mus musculus OX=10090 GN=Babam1 PE=1 SV=1
2	PDB:6gvwD	0.698	0.953	3.614E-41	239	0.699	0.962	6gvwD.pdb.gz	Structural Basis of BRCC36 Function in DNA Repair and Immune Regulation.
3	AFDB:J3KQS6	0.465	0.598	4.461E-34	254	0.772	1.000	J3KQS6.pdb.gz	J3KQS6_HUMAN BRISC and BRCA1 A complex member 1 OS=Homo sapiens OX=9606 GN=BABAM1 PE=1 SV=2
4	AFDB:M0R2I2	0.388	0.536	3.230E-29	237	0.632	0.878	M0R2I2.pdb.gz	M0R2I2_HUMAN BRISC and BRCA1-A complex member 1 (Fragment) OS=Homo sapiens OX=9606 GN=BABAM1 PE=1 SV=1
5	PDB:7ad8D	0.459	0.532	7.926E-11	280	0.085	0.100	7ad8D.pdb.gz	The TFIIH subunits p44/p62 act as a damage sensor during nucleotide excision repair.
6	PDB:7zs96	0.451	0.391	3.596E-10	383	0.073	0.063	7zs96.pdb.gz	Structures of transcription preinitiation complex engaged with the +1 nucleosome.
7	PDB:6gym6	0.463	0.455	1.360E-9	335	0.058	0.057	6gym6.pdb.gz	Promoter Distortion and Opening in the RNA Polymerase II Cleft.
8	AFDB:P55035	0.442	0.374	1.626E-9	396	0.116	0.096	P55035.pdb.gz	PSMD4_DROME 26S proteasome non-ATPase regulatory subunit 4 OS=Drosophila melanogaster OX=7227 GN=Rpn10 PE=1 SV=2
9	PDB:5l4kW	0.473	0.752	7.861E-9	196	0.116	0.194	5l4kW.pdb.gz
10	AFDB:O61742	0.424	0.404	8.327E-9	346	0.103	0.098	O61742.pdb.gz	PSMD4_CAEEL 26S proteasome non-ATPase regulatory subunit 4 OS=Caenorhabditis elegans OX=6239 GN=rpn-10 PE=2 SV=2
11	AFDB:O88321	0.461	0.405	8.327E-9	380	0.112	0.097	O88321.pdb.gz
12	AFDB:B4DJL6	0.451	0.280	1.351E-8	554	0.122	0.072	B4DJL6.pdb.gz	B4DJL6_HUMAN Integrator complex subunit 14 OS=Homo sapiens OX=9606 GN=INTS14 PE=1 SV=1
13	AFDB:Q8VHI5	0.444	0.239	1.828E-8	650	0.125	0.063	Q8VHI5.pdb.gz	VITRN_MOUSE Vitrin OS=Mus musculus OX=10090 GN=Vit PE=1 SV=2
14	PDB:6sn1B	0.430	0.292	6.530E-8	503	0.100	0.066	6sn1B.pdb.gz
15	PDB:7ena2	0.466	0.403	6.937E-8	385	0.109	0.094	7ena2.pdb.gz	Structures of the human Mediator and Mediator-bound preinitiation complex.
16	AFDB:O35701	0.419	0.298	9.943E-8	481	0.100	0.069	O35701.pdb.gz	MATN3_MOUSE Matrilin-3 OS=Mus musculus OX=10090 GN=Matn3 PE=1 SV=2
17	AFDB:G4SNP7	0.361	0.101	1.346E-7	1427	0.152	0.035	G4SNP7.pdb.gz	G4SNP7_CAEEL VWFA domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=dpy-1 PE=1 SV=3
18	PDB:7k0yC	0.392	0.215	8.284E-7	655	0.094	0.047	7k0yC.pdb.gz	Structure of an activated DNA-PK and its implications for NHEJ.
19	PDB:7pksf	0.406	0.264	2.950E-6	536	0.088	0.054	7pksf.pdb.gz	Structural basis of Integrator-mediated transcription regulation.
20	PDB:6jp8F	0.396	0.151	5.402E-6	973	0.067	0.023	6jp8F.pdb.gz	Molecular Basis for Ligand Modulation of a Mammalian Voltage-Gated Ca2+Channel.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q3UI43	0.0	589	333	0.881	0.871	BABA1_MOUSE BRISC and BRCA1-A complex member 1 OS=Mus musculus OX=10090 GN=Babam1 PE=1 SV=1
2	Q9NWV8	0.0	681	329	1.000	1.000	BABA1_HUMAN BRISC and BRCA1-A complex member 1 OS=Homo sapiens OX=9606 GN=BABAM1 PE=1 SV=1
3	M0R0I0	2.27e-165	461	225	0.684	1.000	M0R0I0_HUMAN BRISC and BRCA1-A complex member 1 (Fragment) OS=Homo sapiens OX=9606 GN=BABAM1 PE=1 SV=1
4	M0R2I2	7.35e-151	425	237	0.632	0.878	M0R2I2_HUMAN BRISC and BRCA1-A complex member 1 (Fragment) OS=Homo sapiens OX=9606 GN=BABAM1 PE=1 SV=1
5	M0R193	5.07e-149	419	218	0.635	0.959	M0R193_HUMAN BRISC and BRCA1-A complex member 1 (Fragment) OS=Homo sapiens OX=9606 GN=BABAM1 PE=1 SV=1
6	M0R2K3	1.30e-144	407	200	0.608	1.000	M0R2K3_HUMAN BRISC and BRCA1-A complex member 1 (Fragment) OS=Homo sapiens OX=9606 GN=BABAM1 PE=1 SV=1
7	M0R2A4	6.45e-133	378	193	0.571	0.974	M0R2A4_HUMAN BRISC and BRCA1-A complex member 1 (Fragment) OS=Homo sapiens OX=9606 GN=BABAM1 PE=1 SV=1
8	M0R3F4	3.90e-130	370	181	0.550	1.000	M0R3F4_HUMAN BRISC and BRCA1-A complex member 1 (Fragment) OS=Homo sapiens OX=9606 GN=BABAM1 PE=1 SV=1
9	J3KQS6	7.81e-100	296	254	0.422	0.547	J3KQS6_HUMAN BRISC and BRCA1 A complex member 1 OS=Homo sapiens OX=9606 GN=BABAM1 PE=1 SV=2
10	G1U7D3	1.3	33.5	4598	0.076	0.005	G1U7D3_RABIT Ryanodine receptor 1 OS=Oryctolagus cuniculus OX=9986 GN=RYR1 PE=4 SV=2
11	Q5PRC6	9.9	30.4	557	0.070	0.041	Q5PRC6_DANRE Bifunctional epoxide hydrolase 2 OS=Danio rerio OX=7955 GN=cb523 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13519 VWA_2	68	15.5	von Willebrand factor type A domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000352408

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000298492	0.999	BRISC complex subunit Abraxas 2
2	9606.ENSP00000343412	0.999	BRISC and BRCA1-A complex member 2
3	9606.ENSP00000358474	0.999	Lys-63-specific deubiquitinase BRCC36
4	9606.ENSP00000366434	0.999	BRCA1-A complex subunit RAP80
5	9606.ENSP00000418960	0.999	Breast cancer type 1 susceptibility protein
6	9606.ENSP00000333667	0.998	Serine hydroxymethyltransferase, mitochondrial
7	9606.ENSP00000369857	0.998	BRCA1-A complex subunit Abraxas 1
8	9606.ENSP00000260947	0.961	BRCA1-associated RING domain protein 1
9	9606.ENSP00000426503	0.914	E3 ubiquitin-protein ligase RNF4
10	9606.ENSP00000311579	0.907	Tankyrase-1
11	9606.ENSP00000360689	0.905	Tankyrase-2
12	9606.ENSP00000304697	0.903	Polyubiquitin-B
13	9606.ENSP00000388107	0.903	Ubiquitin-60S ribosomal protein L40
14	9606.ENSP00000348056	0.902	SUMO-conjugating enzyme UBC9
15	9606.ENSP00000441543	0.901	Polyubiquitin-C
16	9606.ENSP00000272317	0.900	Ubiquitin-40S ribosomal protein S27a
17	9606.ENSP00000365588	0.875	Mediator of DNA damage checkpoint protein 1
18	9606.ENSP00000371475	0.863	TP53-binding protein 1
19	9606.ENSP00000362578	0.848	E3 ubiquitin-protein ligase RNF8
20	9606.ENSP00000320898	0.839	E3 ubiquitin-protein ligase RNF168

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.997	cellular process
GO:0071704	0.995	organic substance metabolic process
GO:0044238	0.995	primary metabolic process
GO:0006807	0.993	nitrogen compound metabolic process
GO:0060255	0.988	regulation of macromolecule metabolic process
GO:0048522	0.988	positive regulation of cellular process
GO:0080090	0.987	regulation of primary metabolic process
GO:0051171	0.987	regulation of nitrogen compound metabolic process
GO:0048523	0.987	negative regulation of cellular process
GO:0031323	0.987	regulation of cellular metabolic process
GO:0044260	0.986	cellular macromolecule metabolic process
GO:0006974	0.986	cellular response to DNA damage stimulus
GO:1901987	0.982	regulation of cell cycle phase transition
GO:0051052	0.981	regulation of DNA metabolic process
GO:0006259	0.978	DNA metabolic process
GO:2001020	0.976	regulation of response to DNA damage stimulus
GO:0048584	0.966	positive regulation of response to stimulus
GO:1903047	0.965	mitotic cell cycle process
GO:1901988	0.960	negative regulation of cell cycle phase transition
GO:1901990	0.959	regulation of mitotic cell cycle phase transition
GO:0045930	0.959	negative regulation of mitotic cell cycle
GO:0051173	0.957	positive regulation of nitrogen compound metabolic process
GO:0010604	0.956	positive regulation of macromolecule metabolic process
GO:0042770	0.955	signal transduction in response to DNA damage
GO:0044773	0.953	mitotic DNA damage checkpoint signaling
GO:0045935	0.942	positive regulation of nucleobase-containing compound metabolic process
GO:0010972	0.937	negative regulation of G2/M transition of mitotic cell cycle
GO:0051054	0.933	positive regulation of DNA metabolic process
GO:0043412	0.931	macromolecule modification
GO:0007095	0.926	mitotic G2 DNA damage checkpoint signaling
GO:0006281	0.912	DNA repair
GO:0070647	0.904	protein modification by small protein conjugation or removal
GO:2001022	0.902	positive regulation of response to DNA damage stimulus
GO:0006282	0.902	regulation of DNA repair
GO:0006508	0.684	proteolysis
GO:0009628	0.658	response to abiotic stimulus
GO:0009314	0.653	response to radiation
GO:0010212	0.640	response to ionizing radiation
GO:0006302	0.628	double-strand break repair
GO:0045739	0.589	positive regulation of DNA repair
GO:0070646	0.515	protein modification by small protein removal
GO:0032502	0.496	developmental process
GO:0016579	0.467	protein deubiquitination
GO:0008283	0.408	cell population proliferation
GO:0048856	0.311	anatomical structure development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0016604	1.000	nuclear body
GO:0032991	0.995	protein-containing complex
GO:0140513	0.898	nuclear protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]