StarFunc result for job id Q9NWZ3

User Input

>input (460 residues)
MNKPITPSTYVRCLNVGLIRKLSDFIDPQEGWKKLAVAIKKPSGDDRYNQFHIRRFEALL
QTGKSPTSELLFDWGTTNCTVGDLVDLLIQNEFFAPASLLLPDAVPKTANTLPSKEAITV
QQKQMPFCDKDRTLMTPVQNLEQSYMPPDSSSPENKSLEVSDTRFHSFSFYELKNVTNNF
DERPISVGGNKMGEGGFGVVYKGYVNNTTVAVKKLAAMVDITTEELKQQFDQEIKVMAKC
QHENLVELLGFSSDGDDLCLVYVYMPNGSLLDRLSCLDGTPPLSWHMRCKIAQGAANGIN
FLHENHHIHRDIKSANILLDEAFTAKISDFGLARASEKFAQTVMTSRIVGTTAYMAPEAL
RGEITPKSDIYSFGVVLLEIITGLPAVDEHREPQLLLDIKEEIEDEEKTIEDYIDKKMND
ADSTSVEAMYSVASQCLHEKKNKRPDIKKVQQLLQEMTAS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q69FE3	0.688	0.688	3.541E-75	460	1.000	1.000	Q69FE3.pdb.gz	Q69FE3_HUMAN Interleukin-1 receptor-associated kinase 4 OS=Homo sapiens OX=9606 GN=IRAK4 PE=1 SV=1
2	AFDB:Q8R4K2	0.938	0.940	3.434E-69	459	0.835	0.837	Q8R4K2.pdb.gz	IRAK4_MOUSE Interleukin-1 receptor-associated kinase 4 OS=Mus musculus OX=10090 GN=Irak4 PE=1 SV=1
3	AFDB:Q6IWL3	0.652	0.623	2.107E-48	483	0.489	0.466	Q6IWL3.pdb.gz
4	PDB:8dksA	0.610	0.989	6.128E-45	283	0.613	0.996	8dksA.pdb.gz	Bicyclic pyrimidine compounds as potent IRAK4 inhibitors.
5	AFDB:G5ECP4	0.595	0.566	7.696E-31	485	0.283	0.268	G5ECP4.pdb.gz	PIK1_CAEEL Pelle-like serine/threonine-protein kinase pik-1 OS=Caenorhabditis elegans OX=6239 GN=pik-1 PE=1 SV=1
6	AFDB:P51617	0.622	0.410	6.517E-30	712	0.302	0.195	P51617.pdb.gz	IRAK1_HUMAN Interleukin-1 receptor-associated kinase 1 OS=Homo sapiens OX=9606 GN=IRAK1 PE=1 SV=2
7	AFDB:Q9Y616	0.582	0.453	9.305E-30	596	0.283	0.218	Q9Y616.pdb.gz	IRAK3_HUMAN Interleukin-1 receptor-associated kinase 3 OS=Homo sapiens OX=9606 GN=IRAK3 PE=1 SV=2
8	AFDB:Q8K4B2	0.596	0.455	9.791E-30	609	0.272	0.205	Q8K4B2.pdb.gz	IRAK3_MOUSE Interleukin-1 receptor-associated kinase 3 OS=Mus musculus OX=10090 GN=Irak3 PE=1 SV=2
9	AFDB:B2RYH5	0.659	0.445	6.765E-29	710	0.296	0.192	B2RYH5.pdb.gz	B2RYH5_RAT Interleukin-1 receptor-associated kinase 1 (Predicted) OS=Rattus norvegicus OX=10116 GN=Irak1 PE=2 SV=1
10	AFDB:Q05652	0.588	0.542	4.675E-28	501	0.267	0.246	Q05652.pdb.gz	KPEL_DROME Serine/threonine-protein kinase pelle OS=Drosophila melanogaster OX=7227 GN=pll PE=1 SV=1
11	AFDB:Q8CFA1	0.590	0.450	1.293E-27	622	0.280	0.207	Q8CFA1.pdb.gz	IRAK2_MOUSE Interleukin-1 receptor-associated kinase-like 2 OS=Mus musculus OX=10090 GN=Irak2 PE=2 SV=2
12	PDB:2qkwB	0.546	0.848	1.500E-20	292	0.200	0.315	2qkwB.pdb.gz
13	PDB:5tosA	0.495	0.788	2.395E-17	280	0.217	0.357	5tosA.pdb.gz
14	PDB:6j5tH	0.568	0.785	6.624E-17	327	0.178	0.251	6j5tH.pdb.gz	Reconstitution and structure of a plant NLR resistosome conferring immunity.
15	PDB:1k9aB	0.441	0.459	1.633E-15	441	0.178	0.186	1k9aB.pdb.gz
16	PDB:4krcA	0.470	0.709	5.535E-15	297	0.154	0.239	4krcA.pdb.gz	New Structural Insights into Phosphorylation-free Mechanism for Full Cyclin-dependent Kinase (CDK)-Cyclin Activity and Substrate Recognition.
17	PDB:6j5wB	0.506	0.743	6.127E-15	306	0.174	0.261	6j5wB.pdb.gz	Ligand-triggered allosteric ADP release primes a plant NLR complex.
18	PDB:4zhxA	0.460	0.513	1.187E-14	409	0.152	0.171	4zhxA.pdb.gz	Structural basis of allosteric and synergistic activation of AMPK by furan-2-phosphonic derivative C2 binding.
19	PDB:4rerA	0.439	0.440	4.687E-14	459	0.154	0.155	4rerA.pdb.gz	Structural basis of AMPK regulation by adenine nucleotides and glycogen.
20	PDB:5ufuA	0.455	0.557	1.005E-13	369	0.154	0.192	5ufuA.pdb.gz	Activation of Skeletal Muscle AMPK Promotes Glucose Disposal and Glucose Lowering in Non-human Primates and Mice.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A8I6G1H3	0.0	810	461	0.843	0.842	A0A8I6G1H3_RAT Interleukin-1 receptor-associated kinase 4 OS=Rattus norvegicus OX=10116 GN=Irak4 PE=1 SV=1
2	D4A7K4	0.0	794	455	0.826	0.835	D4A7K4_RAT Interleukin-1 receptor-associated kinase 4 OS=Rattus norvegicus OX=10116 GN=Irak4 PE=1 SV=2
3	Q69FE3	0.0	961	460	1.000	1.000	Q69FE3_HUMAN Interleukin-1 receptor-associated kinase 4 OS=Homo sapiens OX=9606 GN=IRAK4 PE=1 SV=1
4	Q8R4K2	0.0	782	459	0.837	0.839	IRAK4_MOUSE Interleukin-1 receptor-associated kinase 4 OS=Mus musculus OX=10090 GN=Irak4 PE=1 SV=1
5	Q9NWZ3	0.0	961	460	1.000	1.000	IRAK4_HUMAN Interleukin-1 receptor-associated kinase 4 OS=Homo sapiens OX=9606 GN=IRAK4 PE=1 SV=1
6	Q7ZVW7	3.48e-106	322	382	0.348	0.419	Q7ZVW7_DANRE Interleukin-1 receptor-associated kinase 4 OS=Danio rerio OX=7955 GN=zgc:55553 PE=2 SV=1
7	O49840	9.25e-59	201	426	0.254	0.275	PBL3_ARATH Probable serine/threonine-protein kinase PBL3 OS=Arabidopsis thaliana OX=3702 GN=PBL3 PE=1 SV=1
8	Q9FID9	2.04e-57	205	880	0.267	0.140	Y5389_ARATH Probable receptor-like protein kinase At5g38990 OS=Arabidopsis thaliana OX=3702 GN=At5g38990 PE=2 SV=1
9	Q9FE20	5.26e-57	197	456	0.278	0.281	PBS1_ARATH Serine/threonine-protein kinase PBS1 OS=Arabidopsis thaliana OX=3702 GN=PBS1 PE=1 SV=1
10	O49839	9.42e-57	195	426	0.243	0.263	PBL2_ARATH Probable serine/threonine-protein kinase PBL2 OS=Arabidopsis thaliana OX=3702 GN=PBL2 PE=1 SV=1
11	Q0WRY5	1.62e-56	193	378	0.259	0.315	PBL7_ARATH Probable serine/threonine-protein kinase PBL7 OS=Arabidopsis thaliana OX=3702 GN=PBL7 PE=1 SV=1
12	Q9SII6	7.35e-56	192	414	0.272	0.302	PIX13_ARATH Probable serine/threonine-protein kinase PIX13 OS=Arabidopsis thaliana OX=3702 GN=PIX13 PE=1 SV=2
13	F4JEQ2	1.16e-55	191	386	0.267	0.319	PBL23_ARATH Probable serine/threonine-protein kinase PBL23 OS=Arabidopsis thaliana OX=3702 GN=PBL23 PE=2 SV=1
14	C0LGQ7	1.41e-55	200	898	0.272	0.139	Y4245_ARATH Probable LRR receptor-like serine/threonine-protein kinase At4g20450 OS=Arabidopsis thaliana OX=3702 GN=At4g20450 PE=1 SV=1
15	F4HX16	1.47e-55	191	389	0.252	0.298	F4HX16_ARATH Protein kinase superfamily protein OS=Arabidopsis thaliana OX=3702 GN=PBL41 PE=1 SV=1
16	P46573	1.52e-55	192	412	0.261	0.291	PBL10_ARATH Probable serine/threonine-protein kinase PBL10 OS=Arabidopsis thaliana OX=3702 GN=PBL10 PE=1 SV=2
17	Q93ZS4	2.85e-55	196	632	0.261	0.190	NIK3_ARATH Protein NSP-INTERACTING KINASE 3 OS=Arabidopsis thaliana OX=3702 GN=NIK3 PE=1 SV=1
18	Q9SFX0	5.13e-55	189	381	0.263	0.318	PBL22_ARATH Probable serine/threonine-protein kinase PBL22 OS=Arabidopsis thaliana OX=3702 GN=PBL22 PE=2 SV=1
19	Q9LXA5	5.68e-55	196	651	0.252	0.178	LRK91_ARATH L-type lectin-domain containing receptor kinase IX.1 OS=Arabidopsis thaliana OX=3702 GN=LECRK91 PE=1 SV=1
20	Q9ZUF4	1.17e-54	191	462	0.248	0.247	RIPK_ARATH Serine/threonine-protein kinase RIPK OS=Arabidopsis thaliana OX=3702 GN=RIPK PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00531 Death	1.4e+02	14.0	Death domain
2	PF12330 Haspin_kinase	1.2	19.6	Haspin like kinase domain
3	PF00069 Pkinase	4.2e-49	178.9	Protein kinase domain
4	PF17667 Pkinase_fungal	0.35	21.2	Fungal protein kinase
5	PF07714 PK_Tyr_Ser-Thr	1.3e-49	180.4	Protein tyrosine and serine/threonine kinase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000390651

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000401399	0.999	Myeloid differentiation primary response protein MyD88
2	9606.ENSP00000433623	0.999	TNF receptor-associated factor 6
3	9606.ENSP00000256458	0.996	Interleukin-1 receptor-associated kinase-like 2
4	9606.ENSP00000363089	0.992	Toll-like receptor 4
5	9606.ENSP00000376445	0.992	Toll/interleukin-1 receptor domain-containing adapter protein
6	9606.ENSP00000358997	0.991	Interleukin-1 receptor-associated kinase 1
7	9606.ENSP00000386380	0.987	Interleukin-1 receptor type 1
8	9606.ENSP00000260010	0.986	Toll-like receptor 2
9	9606.ENSP00000380697	0.980	Interferon regulatory factor 7
10	9606.ENSP00000314733	0.979	Toll-interacting protein
11	9606.ENSP00000351789	0.978	E3 ubiquitin-protein ligase pellino homolog 1
12	9606.ENSP00000483825	0.973	NF-kappa-B essential modulator
13	9606.ENSP00000263341	0.971	Interleukin-1 beta
14	9606.ENSP00000354932	0.971	Toll-like receptor 1
15	9606.ENSP00000314807	0.966	Interleukin 1 receptor accessory protein
16	9606.ENSP00000415139	0.963	TIR domain-containing adapter molecule 2
17	9606.ENSP00000284818	0.960	Lymphocyte antigen 96
18	9606.ENSP00000261233	0.957	Interleukin-1 receptor-associated kinase 3
19	9606.ENSP00000263339	0.943	Interleukin-1 alpha
20	9606.ENSP00000216160	0.942	TGF-beta-activated kinase 1 and MAP3K7-binding protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0003824	0.948	catalytic activity
GO:0016740	0.905	transferase activity
GO:0016301	0.876	kinase activity
GO:0140096	0.863	catalytic activity, acting on a protein
GO:0004672	0.811	protein kinase activity
GO:0004674	0.778	protein serine/threonine kinase activity
GO:0005102	0.419	signaling receptor binding
GO:0019899	0.410	enzyme binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050896	0.995	response to stimulus
GO:0009987	0.995	cellular process
GO:0050794	0.995	regulation of cellular process
GO:0010033	0.993	response to organic substance
GO:0007166	0.989	cell surface receptor signaling pathway
GO:0070887	0.987	cellular response to chemical stimulus
GO:0019221	0.980	cytokine-mediated signaling pathway
GO:0002218	0.955	activation of innate immune response
GO:0002757	0.950	immune response-activating signaling pathway
GO:0002758	0.932	innate immune response-activating signaling pathway
GO:0002221	0.923	pattern recognition receptor signaling pathway
GO:0006950	0.909	response to stress
GO:0048522	0.858	positive regulation of cellular process
GO:0009966	0.819	regulation of signal transduction
GO:0009605	0.662	response to external stimulus
GO:0030522	0.654	intracellular receptor signaling pathway
GO:0044419	0.629	biological process involved in interspecies interaction between organisms
GO:0009607	0.627	response to biotic stimulus
GO:0043207	0.611	response to external biotic stimulus
GO:0019222	0.560	regulation of metabolic process
GO:0051707	0.535	response to other organism
GO:1902531	0.532	regulation of intracellular signal transduction
GO:0060255	0.526	regulation of macromolecule metabolic process
GO:0006952	0.511	defense response
GO:0071704	0.497	organic substance metabolic process
GO:0031323	0.496	regulation of cellular metabolic process
GO:1902533	0.496	positive regulation of intracellular signal transduction
GO:0080090	0.479	regulation of primary metabolic process
GO:0044238	0.470	primary metabolic process
GO:0051171	0.463	regulation of nitrogen compound metabolic process
GO:0006807	0.459	nitrogen compound metabolic process
GO:0043170	0.452	macromolecule metabolic process
GO:0010468	0.436	regulation of gene expression
GO:0009893	0.432	positive regulation of metabolic process
GO:0010604	0.414	positive regulation of macromolecule metabolic process
GO:0043122	0.411	regulation of I-kappaB kinase/NF-kappaB signaling
GO:1901564	0.394	organonitrogen compound metabolic process
GO:0019538	0.367	protein metabolic process
GO:0002753	0.358	cytosolic pattern recognition receptor signaling pathway
GO:0006955	0.355	immune response
GO:0009889	0.329	regulation of biosynthetic process
GO:0031326	0.318	regulation of cellular biosynthetic process
GO:0002252	0.306	immune effector process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0110165	1.000	cellular anatomical entity
GO:0005575	1.000	cellular_component
GO:0016020	0.981	membrane
GO:0005622	0.978	intracellular anatomical structure
GO:0012505	0.974	endomembrane system
GO:0005737	0.970	cytoplasm
GO:0043227	0.968	membrane-bounded organelle
GO:0005829	0.962	cytosol
GO:0043231	0.952	intracellular membrane-bounded organelle
GO:0071944	0.940	cell periphery
GO:0005576	0.939	extracellular region
GO:0005886	0.933	plasma membrane
GO:0031982	0.924	vesicle
GO:0031090	0.746	organelle membrane
GO:0031410	0.715	cytoplasmic vesicle
GO:0098588	0.615	bounding membrane of organelle
GO:0005768	0.437	endosome
GO:0005634	0.379	nucleus
GO:0012506	0.319	vesicle membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	0.905	Transferases.
EC:2.7.-.-	0.876	Transferring phosphorus-containing groups.
EC:2.7.1.-	0.811	Phosphotransferases with an alcohol group as acceptor.

[back to server]