StarFunc result for job id Q9NWZ5

User Input

>input (548 residues)
MAAPPARADADPSPTSPPTARDTPGRQAEKSETACEDRSNAESLDRLLPPVGTGRSPRKR
TTSQCKSEPPLLRTSKRTIYTAGRPPWYNEHGTQSKEAFAIGLGGGSASGKTTVARMIIE
ALDVPWVVLLSMDSFYKVLTEQQQEQAAHNNFNFDHPDAFDFDLIISTLKKLKQGKSVKV
PIYDFTTHSRKKDWKTLYGANVIIFEGIMAFADKTLLELLDMKIFVDTDSDIRLVRRLRR
DISERGRDIEGVIKQYNKFVKPSFDQYIQPTMRLADIVVPRGSGNTVAIDLIVQHVHSQL
EERELSVRAALASAHQCHPLPRTLSVLKSTPQVRGMHTIIRDKETSRDEFIFYSKRLMRL
LIEHALSFLPFQDCVVQTPQGQDYAGKCYAGKQITGVSILRAGETMEPALRAVCKDVRIG
TILIQTNQLTGEPELHYLRLPKDISDDHVILMDCTVSTGAAAMMAVRVLLDHDVPEDKIF
LLSLLMAEMGVHSVAYAFPRVRIITTAVDKRVNDLFRIIPGIGNFGDRYFGTDAVPDGSD
EEEVAYTG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9NWZ5	1.000	1.000	0.000	548	1.000	1.000	Q9NWZ5.pdb.gz	UCKL1_HUMAN Uridine-cytidine kinase-like 1 OS=Homo sapiens OX=9606 GN=UCKL1 PE=1 SV=2
2	AFDB:H2L2A8	0.791	0.763	3.679E-69	569	0.502	0.483	H2L2A8.pdb.gz	H2L2A8_CAEEL Uridine kinase OS=Caenorhabditis elegans OX=6239 GN=CELE_F19B6.1 PE=1 SV=1
3	AFDB:Q9FKS0	0.379	0.426	1.659E-57	486	0.385	0.434	Q9FKS0.pdb.gz	UKL1_ARATH Uridine/cytidine kinase UKL1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=UKL1 PE=1 SV=1
4	AFDB:Q8VYB2	0.384	0.451	7.484E-56	466	0.376	0.442	Q8VYB2.pdb.gz	UKL3_ARATH Uridine kinase-like protein 3 OS=Arabidopsis thaliana OX=3702 GN=UKL3 PE=2 SV=1
5	AFDB:O74427	0.721	0.861	2.024E-52	454	0.310	0.374	O74427.pdb.gz	URK1_SCHPO Uridine kinase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=urk1 PE=3 SV=1
6	AFDB:P27515	0.707	0.768	9.129E-49	501	0.307	0.335	P27515.pdb.gz	URK1_YEAST Uridine kinase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=URK1 PE=1 SV=1
7	AFDB:Q99PM9	0.380	0.783	1.438E-28	261	0.215	0.452	Q99PM9.pdb.gz	UCK2_MOUSE Uridine-cytidine kinase 2 OS=Mus musculus OX=10090 GN=Uck2 PE=1 SV=1
8	AFDB:P52623	0.370	0.725	2.611E-27	277	0.193	0.383	P52623.pdb.gz	UCK1_MOUSE Uridine-cytidine kinase 1 OS=Mus musculus OX=10090 GN=Uck1 PE=1 SV=2
9	AFDB:P18562	0.380	0.957	1.145E-26	216	0.170	0.431	P18562.pdb.gz	UPP_YEAST Uracil phosphoribosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=FUR1 PE=1 SV=2
10	AFDB:O13867	0.390	0.966	7.063E-26	219	0.170	0.425	O13867.pdb.gz	UPP1_SCHPO Uracil phosphoribosyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC1B3.01c PE=3 SV=1
11	PDB:6pwzB	0.360	0.887	5.717E-24	215	0.201	0.512	6pwzB.pdb.gz	Incorporation of novel azido-nucleotides into RNA
12	PDB:2ehjA	0.354	0.889	4.064E-18	208	0.100	0.264	2ehjA.pdb.gz
13	PDB:5e38D	0.345	0.845	7.814E-15	213	0.102	0.263	5e38D.pdb.gz
14	PDB:6h7gA	0.291	0.456	2.889E-12	340	0.099	0.159	6h7gA.pdb.gz
15	PDB:5e38B	0.293	0.860	6.049E-12	175	0.088	0.274	5e38B.pdb.gz
16	PDB:5xmbB	0.301	0.591	1.636E-10	267	0.069	0.142	5xmbB.pdb.gz
17	PDB:2gesA	0.300	0.511	2.054E-10	308	0.080	0.143	2gesA.pdb.gz	Invariance and variability in bacterial PanK: a study based on the crystal structure of Mycobacterium tuberculosis PanK.
18	PDB:1esmA	0.298	0.501	6.049E-10	311	0.086	0.151	1esmA.pdb.gz	Structural basis for the feedback regulation of Escherichia coli pantothenate kinase by coenzyme A.
19	PDB:2p0eA	0.260	0.672	6.402E-8	190	0.071	0.205	2p0eA.pdb.gz	Nicotinamide Riboside Kinase Structures Reveal New Pathways to NAD(+).
20	PDB:1odfA	0.255	0.455	2.367E-7	280	0.078	0.154	1odfA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	H2L2A8	0.0	546	569	0.491	0.473	H2L2A8_CAEEL Uridine kinase OS=Caenorhabditis elegans OX=6239 GN=CELE_F19B6.1 PE=1 SV=1
2	Q9NWZ5	0.0	1134	548	1.000	1.000	UCKL1_HUMAN Uridine-cytidine kinase-like 1 OS=Homo sapiens OX=9606 GN=UCKL1 PE=1 SV=2
3	Q9FKS0	2.19e-143	424	486	0.381	0.430	UKL1_ARATH Uridine/cytidine kinase UKL1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=UKL1 PE=1 SV=1
4	Q9LK34	2.21e-143	424	483	0.378	0.429	UKL2_ARATH Uridine/cytidine kinase UKL1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=UKL2 PE=1 SV=1
5	Q8VYB2	1.55e-138	411	466	0.389	0.457	UKL3_ARATH Uridine kinase-like protein 3 OS=Arabidopsis thaliana OX=3702 GN=UKL3 PE=2 SV=1
6	O74427	3.68e-109	335	454	0.312	0.377	URK1_SCHPO Uridine kinase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=urk1 PE=3 SV=1
7	P27515	2.09e-89	286	501	0.297	0.325	URK1_YEAST Uridine kinase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=URK1 PE=1 SV=1
8	Q9BZX2	8.89e-74	237	261	0.203	0.425	UCK2_HUMAN Uridine-cytidine kinase 2 OS=Homo sapiens OX=9606 GN=UCK2 PE=1 SV=1
9	Q99PM9	2.32e-73	236	261	0.203	0.425	UCK2_MOUSE Uridine-cytidine kinase 2 OS=Mus musculus OX=10090 GN=Uck2 PE=1 SV=1
10	Q9QYG8	2.32e-73	236	261	0.203	0.425	UCK2_RAT Uridine-cytidine kinase 2 OS=Rattus norvegicus OX=10116 GN=Uck2 PE=2 SV=2
11	P52623	3.39e-65	215	277	0.188	0.372	UCK1_MOUSE Uridine-cytidine kinase 1 OS=Mus musculus OX=10090 GN=Uck1 PE=1 SV=2
12	Q9HA47	1.21e-64	214	277	0.188	0.372	UCK1_HUMAN Uridine-cytidine kinase 1 OS=Homo sapiens OX=9606 GN=UCK1 PE=1 SV=1
13	P18562	2.54e-58	195	216	0.170	0.431	UPP_YEAST Uracil phosphoribosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=FUR1 PE=1 SV=2
14	O13867	1.02e-57	194	219	0.168	0.420	UPP1_SCHPO Uracil phosphoribosyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC1B3.01c PE=3 SV=1
15	A0A0S2Z5Y6	1.57e-53	182	210	0.172	0.448	A0A0S2Z5Y6_HUMAN uridine/cytidine kinase (Fragment) OS=Homo sapiens OX=9606 GN=UCK1 PE=1 SV=1
16	Q9HE15	5.75e-45	160	220	0.144	0.359	UPP2_SCHPO Uracil phosphoribosyltransferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC1399.04c PE=3 SV=1
17	Q9VRQ1	9.95e-45	160	261	0.159	0.333	Q9VRQ1_DROME Krishah, isoform A OS=Drosophila melanogaster OX=7227 GN=kri PE=1 SV=1
18	P0A8F4	2.08e-44	158	213	0.146	0.376	URK_ECOLI Uridine kinase OS=Escherichia coli (strain K12) OX=83333 GN=udk PE=3 SV=1
19	P67413	2.45e-44	158	212	0.144	0.373	URK_STRPN Uridine kinase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=udk PE=1 SV=1
20	A0A8I6G3Q5	3.25e-44	160	309	0.164	0.291	A0A8I6G3Q5_RAT Uracil phosphoribosyltransferase homolog OS=Rattus norvegicus OX=10116 GN=Uprt PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13207 AAA_17	54	15.7	AAA domain
2	PF13238 AAA_18	1.1	21.2	AAA domain
3	PF13671 AAA_33	23	16.6	AAA domain
4	PF01121 CoaE	96	14.1	Dephospho-CoA kinase
5	PF07931 CPT	0.0028	29.0	Chloramphenicol phosphotransferase-like protein
6	PF02224 Cytidylate_kin	11	17.2	Cytidylate kinase
7	PF00485 PRK	1.4e-56	203.0	Phosphoribulokinase / Uridine kinase family
8	PF14681 UPRTase	1.2e-67	239.0	Uracil phosphoribosyltransferase
9	PF06414 Zeta_toxin	24	15.8	Zeta toxin

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000346155

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000362481	0.997	Uracil phosphoribosyltransferase homolog
2	9606.ENSP00000232607	0.978	Uridine 5'-monophosphate synthase
3	9606.ENSP00000364212	0.970	Cytidine deaminase
4	9606.ENSP00000330032	0.964	Uridine phosphorylase 1
5	9606.ENSP00000362555	0.958	E3 ubiquitin-protein ligase RNF19B
6	9606.ENSP00000356853	0.949	Uridine-cytidine kinase 2
7	9606.ENSP00000474090	0.942	Uridine phosphorylase 2
8	9606.ENSP00000328551	0.941	Ras-related protein Rab-28
9	9606.ENSP00000360561	0.928	Ectonucleoside triphosphate diphosphohydrolase 8
10	9606.ENSP00000256722	0.921	UMP-CMP kinase 2, mitochondrial
11	9606.ENSP00000360250	0.914	Ectonucleoside triphosphate diphosphohydrolase 1
12	9606.ENSP00000301825	0.912	Ectonucleoside triphosphate diphosphohydrolase 3
13	9606.ENSP00000354238	0.902	Ectonucleotide pyrophosphatase/phosphodiesterase family member 1
14	9606.ENSP00000406261	0.902	Ectonucleotide pyrophosphatase/phosphodiesterase family member 3
15	9606.ENSP00000361285	0.877	Uridine-cytidine kinase 1
16	9606.ENSP00000360939	0.753	UMP-CMP kinase
17	9606.ENSP00000307674	0.727	Soluble calcium-activated nucleotidase 1
18	9606.ENSP00000335246	0.713	Ectonucleoside triphosphate diphosphohydrolase 5
19	9606.ENSP00000361704	0.707	CTP synthase 1
20	9606.ENSP00000388137	0.683	Metallophosphoesterase domain-containing protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004849	0.996	uridine kinase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044238	0.999	primary metabolic process
GO:0044281	0.997	small molecule metabolic process
GO:1901564	0.997	organonitrogen compound metabolic process
GO:1901360	0.995	organic cyclic compound metabolic process
GO:0046483	0.995	heterocycle metabolic process
GO:0006725	0.995	cellular aromatic compound metabolic process
GO:0034641	0.995	cellular nitrogen compound metabolic process
GO:0055086	0.992	nucleobase-containing small molecule metabolic process
GO:1901135	0.990	carbohydrate derivative metabolic process
GO:0072528	0.985	pyrimidine-containing compound biosynthetic process
GO:0019438	0.976	aromatic compound biosynthetic process
GO:1901137	0.957	carbohydrate derivative biosynthetic process
GO:1901657	0.946	glycosyl compound metabolic process
GO:0034654	0.942	nucleobase-containing compound biosynthetic process
GO:1901659	0.899	glycosyl compound biosynthetic process
GO:0009116	0.876	nucleoside metabolic process
GO:0043094	0.769	cellular metabolic compound salvage
GO:0044283	0.629	small molecule biosynthetic process
GO:0009117	0.434	nucleotide metabolic process
GO:0050789	0.325	regulation of biological process
GO:0050794	0.316	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0043229	0.927	intracellular organelle
GO:0043227	0.852	membrane-bounded organelle
GO:0043231	0.830	intracellular membrane-bounded organelle
GO:0005634	0.308	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:16825	0.996	ATP + uridine = ADP + H(+) + UMP
EC:2.7.1.48	0.996	uridine/cytidine kinase.

[back to server]