StarFunc result for job id Q9NX01

User Input

>input (149 residues)
MSFLLPKLTSKKEVDQAIKSTAEKVLVLRFGRDEDPVCLQLDDILSKTSSDLSKMAAIYL
VDVDQTAVYTQYFDISYIPSTVFFFNGQHMKVDYGSPDHTKFVGSFKTKQDFIDLIEVIY
RGAMRGKLIVQSPIDPKNIPKYDLLYQDI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9NX01	1.000	1.000	2.739E-34	149	1.000	1.000	Q9NX01.pdb.gz	TXN4B_HUMAN Thioredoxin-like protein 4B OS=Homo sapiens OX=9606 GN=TXNL4B PE=1 SV=1
2	PDB:4in0A	0.934	0.987	9.265E-29	141	0.946	1.000	4in0A.pdb.gz
3	AFDB:Q6NMD4	0.970	0.910	1.084E-24	159	0.597	0.560	Q6NMD4.pdb.gz	Q6NMD4_ARATH At3g24730 OS=Arabidopsis thaliana OX=3702 GN=At3g24730 PE=1 SV=1
4	AFDB:P83876	0.894	0.937	5.313E-18	142	0.336	0.352	P83876.pdb.gz	TXN4A_HUMAN Thioredoxin-like protein 4A OS=Homo sapiens OX=9606 GN=TXNL4A PE=1 SV=1
5	AFDB:Q9FE62	0.891	0.934	5.670E-18	142	0.349	0.366	Q9FE62.pdb.gz	YLS8_ARATH Thioredoxin-like protein YLS8 OS=Arabidopsis thaliana OX=3702 GN=YLS8 PE=1 SV=1
6	AFDB:Q06819	0.881	0.918	6.890E-18	143	0.315	0.329	Q06819.pdb.gz	DIB1_YEAST Spliceosomal protein DIB1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DIB1 PE=1 SV=1
7	AFDB:H3BN11	0.633	0.803	7.633E-17	117	0.644	0.821	H3BN11.pdb.gz	H3BN11_HUMAN Thioredoxin like 4B (Fragment) OS=Homo sapiens OX=9606 GN=TXNL4B PE=1 SV=1
8	PDB:4cdoA	0.856	0.851	6.468E-16	150	0.322	0.320	4cdoA.pdb.gz
9	PDB:5nrlD	0.854	0.894	6.120E-14	142	0.315	0.331	5nrlD.pdb.gz	Structure of a pre-catalytic spliceosome.
10	AFDB:Q57XD3	0.796	0.766	2.676E-12	155	0.215	0.206	Q57XD3.pdb.gz	Q57XD3_TRYB2 Spliceosomal U5 snRNP-specific protein, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.26A17.540 PE=3 SV=1
11	AFDB:K7ES07	0.570	0.817	1.058E-9	103	0.208	0.301	K7ES07.pdb.gz	K7ES07_HUMAN Thioredoxin like 4A OS=Homo sapiens OX=9606 GN=TXNL4A PE=1 SV=1
12	PDB:1xwaA	0.613	0.804	2.087E-8	111	0.174	0.234	1xwaA.pdb.gz
13	AFDB:Q9V429	0.635	0.872	2.104E-8	106	0.161	0.226	Q9V429.pdb.gz	THIO2_DROME Thioredoxin-2 OS=Drosophila melanogaster OX=7227 GN=Trx-2 PE=1 SV=3
14	AFDB:P22803	0.566	0.792	3.776E-8	104	0.168	0.240	P22803.pdb.gz	TRX2_YEAST Thioredoxin-2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TRX2 PE=1 SV=3
15	PDB:3f3qA	0.580	0.769	4.553E-8	109	0.168	0.229	3f3qA.pdb.gz	Structural and kinetic analysis of Saccharomyces cerevisiae thioredoxin Trx1: implications for the catalytic mechanism of GSSG reduced by the thioredoxin system
16	PDB:2fa4A	0.557	0.779	4.858E-8	104	0.168	0.240	2fa4A.pdb.gz
17	PDB:6z7oA	0.623	0.822	7.657E-8	110	0.154	0.209	6z7oA.pdb.gz	Structures of the germline-specific Deadhead and thioredoxin T proteins from Drosophila melanogaster reveal unique features among thioredoxins.
18	PDB:5xocB	0.594	0.659	2.030E-7	133	0.141	0.158	5xocB.pdb.gz
19	PDB:2l4qA	0.609	0.762	2.312E-7	116	0.141	0.181	2l4qA.pdb.gz
20	PDB:6yt3B	0.651	0.273	5.043E-7	376	0.121	0.048	6yt3B.pdb.gz	Chimeric single alpha-helical domains as rigid fusion protein connections for protein nanotechnology and structural biology.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9NX01	2.78e-106	301	149	1.000	1.000	TXN4B_HUMAN Thioredoxin-like protein 4B OS=Homo sapiens OX=9606 GN=TXNL4B PE=1 SV=1
2	H3BN11	1.28e-64	194	117	0.644	0.821	H3BN11_HUMAN Thioredoxin like 4B (Fragment) OS=Homo sapiens OX=9606 GN=TXNL4B PE=1 SV=1
3	Q6NMD4	2.97e-64	195	159	0.604	0.566	Q6NMD4_ARATH At3g24730 OS=Arabidopsis thaliana OX=3702 GN=At3g24730 PE=1 SV=1
4	H3BUL8	4.24e-63	190	94	0.631	1.000	H3BUL8_HUMAN Thioredoxin like 4B (Fragment) OS=Homo sapiens OX=9606 GN=TXNL4B PE=1 SV=8
5	Q9FE62	8.51e-35	120	142	0.376	0.394	YLS8_ARATH Thioredoxin-like protein YLS8 OS=Arabidopsis thaliana OX=3702 GN=YLS8 PE=1 SV=1
6	P83876	2.41e-33	116	142	0.356	0.373	TXN4A_HUMAN Thioredoxin-like protein 4A OS=Homo sapiens OX=9606 GN=TXNL4A PE=1 SV=1
7	P83877	2.41e-33	116	142	0.356	0.373	TXN4A_MOUSE Thioredoxin-like protein 4A OS=Mus musculus OX=10090 GN=Txnl4a PE=1 SV=1
8	Q8SZ87	9.07e-33	114	142	0.349	0.366	Q8SZ87_DROME Thioredoxin-like protein OS=Drosophila melanogaster OX=7227 GN=Dim1 PE=2 SV=1
9	Q06819	1.37e-28	104	143	0.315	0.329	DIB1_YEAST Spliceosomal protein DIB1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DIB1 PE=1 SV=1
10	O14835	5.23e-19	78.2	91	0.235	0.385	O14835_HUMAN Dim1p homolog OS=Homo sapiens OX=9606 GN=TXNL4A PE=1 SV=1
11	K7ES07	4.14e-18	76.3	103	0.228	0.330	K7ES07_HUMAN Thioredoxin like 4A OS=Homo sapiens OX=9606 GN=TXNL4A PE=1 SV=1
12	Q57XD3	4.37e-06	45.8	155	0.215	0.206	Q57XD3_TRYB2 Spliceosomal U5 snRNP-specific protein, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.26A17.540 PE=3 SV=1
13	O76003	3.22e-04	41.6	335	0.154	0.069	GLRX3_HUMAN Glutaredoxin-3 OS=Homo sapiens OX=9606 GN=GLRX3 PE=1 SV=2
14	Q9JLZ1	0.002	39.3	337	0.174	0.077	GLRX3_RAT Glutaredoxin-3 OS=Rattus norvegicus OX=10116 GN=Glrx3 PE=1 SV=2
15	Q9CQM9	0.003	38.9	337	0.128	0.056	GLRX3_MOUSE Glutaredoxin-3 OS=Mus musculus OX=10090 GN=Glrx3 PE=1 SV=1
16	Q6FND5	0.043	34.3	103	0.188	0.272	Q6FND5_CANGA Thioredoxin OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=TRX2 PE=3 SV=1
17	Q9DGI3	0.048	34.3	107	0.154	0.215	THIO_ICTPU Thioredoxin OS=Ictalurus punctatus OX=7998 GN=txn PE=3 SV=1
18	Q5XJ54	0.057	35.0	326	0.101	0.046	GLRX3_DANRE Glutaredoxin 3 OS=Danio rerio OX=7955 GN=glrx3 PE=2 SV=1
19	P22803	0.069	33.5	104	0.154	0.221	TRX2_YEAST Thioredoxin-2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TRX2 PE=1 SV=3
20	C0H561	0.14	33.1	128	0.107	0.125	C0H561_PLAF7 Thioredoxin-like protein 2 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0925500 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02966 DIM1	4.5e-53	190.0	Mitosis protein DIM1
2	PF00085 Thioredoxin	0.0092	27.3	Thioredoxin

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000268483

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000266079	0.954	Pre-mRNA-processing factor 6
2	9606.ENSP00000317123	0.942	U5 small nuclear ribonucleoprotein 200 kDa helicase
3	9606.ENSP00000324122	0.926	U4/U6 small nuclear ribonucleoprotein Prp31
4	9606.ENSP00000215829	0.911	Small nuclear ribonucleoprotein Sm D3
5	9606.ENSP00000310448	0.909	U4/U6.U5 tri-snRNP-associated protein 1
6	9606.ENSP00000252622	0.900	U6 snRNA-associated Sm-like protein LSm7
7	9606.ENSP00000302160	0.900	U6 snRNA-associated Sm-like protein LSm3
8	9606.ENSP00000392094	0.883	116 kDa U5 small nuclear ribonucleoprotein component
9	9606.ENSP00000266735	0.866	Small nuclear ribonucleoprotein F
10	9606.ENSP00000422392	0.854	U6 snRNA-associated Sm-like protein LSm6
11	9606.ENSP00000272348	0.845	Small nuclear ribonucleoprotein G
12	9606.ENSP00000410758	0.827	U6 snRNA-associated Sm-like protein LSm5
13	9606.ENSP00000382972	0.821	Small nuclear ribonucleoprotein-associated protein N
14	9606.ENSP00000412566	0.821	Small nuclear ribonucleoprotein-associated proteins B and B
15	9606.ENSP00000274712	0.815	Zinc finger matrin-type 2
16	9606.ENSP00000460348	0.812	Pre-mRNA-processing-splicing factor 8
17	9606.ENSP00000261973	0.810	RNA-binding protein 25
18	9606.ENSP00000268802	0.807	RNA-binding protein NOB1
19	9606.ENSP00000249299	0.797	U6 snRNA-associated Sm-like protein LSm8
20	9606.ENSP00000469468	0.793	U6 snRNA-associated Sm-like protein LSm4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003824	0.566	catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0006396	0.995	RNA processing
GO:0000398	0.991	mRNA splicing, via spliceosome
GO:0071826	0.989	ribonucleoprotein complex subunit organization
GO:0022613	0.987	ribonucleoprotein complex biogenesis
GO:0065003	0.986	protein-containing complex assembly
GO:0022618	0.975	ribonucleoprotein complex assembly
GO:0000245	0.463	spliceosomal complex assembly
GO:0065007	0.351	biological regulation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0005829	0.999	cytosol
GO:0032991	0.362	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]