StarFunc result for job id Q9NX02

User Input

>input (1062 residues)
MVSSAQMGFNLQALLEQLSQDELSKFKYLITTFSLAHELQKIPHKEVDKADGKQLVEILT
THCDSYWVEMASLQVFEKMHRMDLSERAKDEVREAALKSFNKRKPLSLGITRKERPPLDV
DEMLERFKTEAQAFTETKGNVICLGKEVFKGKKPDKDNRCRYILKTKFREMWKSWPGDSK
EVQVMAERYKMLIPFSNPRVLPGPFSYTVVLYGPAGLGKTTLAQKLMLDWAEDNLIHKFK
YAFYLSCRELSRLGPCSFAELVFRDWPELQDDIPHILAQARKILFVIDGFDELGAAPGAL
IEDICGDWEKKKPVPVLLGSLLNRVMLPKAALLVTTRPRALRDLRILAEEPIYIRVEGFL
EEDRRAYFLRHFGDEDQAMRAFELMRSNAALFQLGSAPAVCWIVCTTLKLQMEKGEDPVP
TCLTRTGLFLRFLCSRFPQGAQLRGALRTLSLLAAQGLWAQTSVLHREDLERLGVQESDL
RLFLDGDILRQDRVSKGCYSFIHLSFQQFLTALFYTLEKEEEEDRDGHTWDIGDVQKLLS
GVERLRNPDLIQAGYYSFGLANEKRAKELEATFGCRMSPDIKQELLRCDISCKGGHSTVT
DLQELLGCLYESQEEELVKEVMAQFKEISLHLNAVDVVPSSFCVKHCRNLQKMSLQVIKE
NLPENVTASESDAEVERSQDDQHMLPFWTDLCSIFGSNKDLMGLAINDSFLSASLVRILC
EQIASDTCHLQRVVFKNISPADAHRNLCLALRGHKTVTYLTLQGNDQDDMFPALCEVLRH
PECNLRYLGLVSCSATTQQWADLSLALEVNQSLTCVNLSDNELLDEGAKLLYTTLRHPKC
FLQRLSLENCHLTEANCKDLAAVLVVSRELTHLCLAKNPIGNTGVKFLCEGLRYPECKLQ
TLVLWNCDITSDGCCDLTKLLQEKSSLLCLDLGLNHIGVKGMKFLCEALRKPLCNLRCLW
LWGCSIPPFSCEDLCSALSCNQSLVTLDLGQNPLGSSGVKMLFETLTCSSGTLRTLRLKI
DDFNDELNKLLEEIEEKNPQLIIDTEKHHPWAERPSSHDFMI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9NX02	1.000	1.000	0.000	1062	1.000	1.000	Q9NX02.pdb.gz	NALP2_HUMAN NACHT, LRR and PYD domains-containing protein 2 OS=Homo sapiens OX=9606 GN=NLRP2 PE=1 SV=1
2	AFDB:Q8WX94	0.710	0.766	3.178E-94	980	0.588	0.637	Q8WX94.pdb.gz	NALP7_HUMAN NACHT, LRR and PYD domains-containing protein 7 OS=Homo sapiens OX=9606 GN=NLRP7 PE=1 SV=1
3	AFDB:Q86W24	0.675	0.658	1.634E-67	1093	0.361	0.350	Q86W24.pdb.gz	NAL14_HUMAN NACHT, LRR and PYD domains-containing protein 14 OS=Homo sapiens OX=9606 GN=NLRP14 PE=1 SV=1
4	AFDB:Q96MN2	0.655	0.694	1.211E-60	994	0.320	0.342	Q96MN2.pdb.gz	NALP4_HUMAN NACHT, LRR and PYD domains-containing protein 4 OS=Homo sapiens OX=9606 GN=NLRP4 PE=1 SV=3
5	AFDB:Q7RTR0	0.670	0.714	2.581E-60	991	0.305	0.327	Q7RTR0.pdb.gz	NLRP9_HUMAN NACHT, LRR and PYD domains-containing protein 9 OS=Homo sapiens OX=9606 GN=NLRP9 PE=1 SV=1
6	AFDB:D4A523	0.454	0.464	1.174E-59	1035	0.322	0.330	D4A523.pdb.gz	NLRP3_RAT NACHT, LRR and PYD domains-containing protein 3 OS=Rattus norvegicus OX=10116 GN=Nlrp3 PE=3 SV=2
7	AFDB:P59047	0.697	0.625	1.576E-59	1200	0.301	0.267	P59047.pdb.gz	NALP5_HUMAN NACHT, LRR and PYD domains-containing protein 5 OS=Homo sapiens OX=9606 GN=NLRP5 PE=1 SV=2
8	AFDB:P59046	0.682	0.682	5.566E-59	1061	0.319	0.320	P59046.pdb.gz	NAL12_HUMAN NACHT, LRR and PYD domains-containing protein 12 OS=Homo sapiens OX=9606 GN=NLRP12 PE=1 SV=2
9	AFDB:E9Q5R7	0.647	0.651	1.465E-58	1054	0.313	0.315	E9Q5R7.pdb.gz	NAL12_MOUSE NACHT, LRR and PYD domains-containing protein 12 OS=Mus musculus OX=10090 GN=Nlrp12 PE=1 SV=1
10	AFDB:Q96P20	0.438	0.448	2.531E-58	1036	0.318	0.326	Q96P20.pdb.gz	NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3 OS=Homo sapiens OX=9606 GN=NLRP3 PE=1 SV=3
11	PDB:7pzcA	0.544	0.566	2.283E-44	1010	0.315	0.332	7pzcA.pdb.gz	Structure of the NLRP3 decamer bound to the cytokine release inhibitor CRID3.
12	PDB:7lfhA	0.518	0.645	5.791E-36	806	0.281	0.370	7lfhA.pdb.gz
13	PDB:6npyA	0.517	0.651	6.056E-32	798	0.254	0.338	6npyA.pdb.gz	Structural mechanism for NEK7-licensed activation of NLRP3 inflammasome.
14	PDB:4kxfP	0.332	0.384	5.103E-21	866	0.148	0.181	4kxfP.pdb.gz	Crystal structure of NLRC4 reveals its autoinhibition mechanism
15	PDB:1a4yA	0.349	0.771	7.860E-20	460	0.112	0.259	1a4yA.pdb.gz
16	PDB:3jblA	0.267	0.299	2.163E-15	909	0.136	0.158	3jblA.pdb.gz
17	PDB:6b5bA	0.232	0.209	2.618E-13	1199	0.163	0.144	6b5bA.pdb.gz
18	PDB:6j5wA	0.175	0.214	3.106E-9	816	0.133	0.173	6j5wA.pdb.gz	Ligand-triggered allosteric ADP release primes a plant NLR complex.
19	PDB:5yudA	0.288	0.257	3.378E-9	1238	0.145	0.124	5yudA.pdb.gz	Structural basis for specific flagellin recognition by the NLR protein NAIP5.
20	PDB:1k5dC	0.225	0.566	1.031E-6	344	0.066	0.203	1k5dC.pdb.gz	RanGAP mediates GTP hydrolysis without an arginine finger.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	J3KN39	0.0	2171	1059	0.997	1.000	J3KN39_HUMAN NACHT, LRR and PYD domains-containing protein 2 OS=Homo sapiens OX=9606 GN=NLRP2 PE=1 SV=1
2	Q86W24	0.0	581	1093	0.373	0.362	NAL14_HUMAN NACHT, LRR and PYD domains-containing protein 14 OS=Homo sapiens OX=9606 GN=NLRP14 PE=1 SV=1
3	Q8WX94	0.0	1140	980	0.573	0.620	NALP7_HUMAN NACHT, LRR and PYD domains-containing protein 7 OS=Homo sapiens OX=9606 GN=NLRP7 PE=1 SV=1
4	Q9NX02	0.0	2182	1062	1.000	1.000	NALP2_HUMAN NACHT, LRR and PYD domains-containing protein 2 OS=Homo sapiens OX=9606 GN=NLRP2 PE=1 SV=1
5	Q96MN2	2.12e-155	489	994	0.330	0.352	NALP4_HUMAN NACHT, LRR and PYD domains-containing protein 4 OS=Homo sapiens OX=9606 GN=NLRP4 PE=1 SV=3
6	Q7RTR0	2.17e-154	486	991	0.319	0.342	NLRP9_HUMAN NACHT, LRR and PYD domains-containing protein 9 OS=Homo sapiens OX=9606 GN=NLRP9 PE=1 SV=1
7	Q96P20	3.14e-150	476	1036	0.331	0.340	NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3 OS=Homo sapiens OX=9606 GN=NLRP3 PE=1 SV=3
8	P59046	1.16e-149	476	1061	0.331	0.331	NAL12_HUMAN NACHT, LRR and PYD domains-containing protein 12 OS=Homo sapiens OX=9606 GN=NLRP12 PE=1 SV=2
9	E9Q5R7	1.19e-148	473	1054	0.334	0.337	NAL12_MOUSE NACHT, LRR and PYD domains-containing protein 12 OS=Mus musculus OX=10090 GN=Nlrp12 PE=1 SV=1
10	Q8R4B8	1.30e-143	459	1033	0.324	0.333	NLRP3_MOUSE NACHT, LRR and PYD domains-containing protein 3 OS=Mus musculus OX=10090 GN=Nlrp3 PE=1 SV=1
11	D4A523	2.59e-142	455	1035	0.326	0.334	NLRP3_RAT NACHT, LRR and PYD domains-containing protein 3 OS=Rattus norvegicus OX=10116 GN=Nlrp3 PE=3 SV=2
12	Q9R1M5	4.57e-136	442	1163	0.266	0.242	NALP5_MOUSE NACHT, LRR and PYD domains-containing protein 5 OS=Mus musculus OX=10090 GN=Nlrp5 PE=1 SV=2
13	P59047	1.14e-135	442	1200	0.313	0.277	NALP5_HUMAN NACHT, LRR and PYD domains-containing protein 5 OS=Homo sapiens OX=9606 GN=NLRP5 PE=1 SV=2
14	F1MT67	1.27e-133	434	1098	0.302	0.292	F1MT67_BOVIN NLR family pyrin domain containing 5 OS=Bos taurus OX=9913 GN=NLRP5 PE=3 SV=3
15	K7EMK2	8.22e-133	401	197	0.183	0.985	K7EMK2_HUMAN NACHT, LRR and PYD domains-containing protein 2 (Fragment) OS=Homo sapiens OX=9606 GN=NLRP2 PE=1 SV=1
16	Q647I9	6.63e-132	429	1098	0.298	0.289	NALP5_BOVIN NACHT, LRR and PYD domains-containing protein 5 OS=Bos taurus OX=9913 GN=NLRP5 PE=2 SV=1
17	Q3UWL9	2.57e-120	394	944	0.280	0.315	Q3UWL9_MOUSE NACHT, LRR and PYD domains-containing protein 4F OS=Mus musculus OX=10090 GN=Nlrp4g PE=2 SV=1
18	Q66X22	5.98e-111	370	1003	0.293	0.310	NLR9B_MOUSE NACHT, LRR and PYD domains-containing protein 9B OS=Mus musculus OX=10090 GN=Nlrp9b PE=1 SV=1
19	Q66X05	2.41e-104	351	959	0.225	0.249	NAL4F_MOUSE NACHT, LRR and PYD domains-containing protein 4F OS=Mus musculus OX=10090 GN=Nlrp4f PE=1 SV=1
20	Q66X03	1.79e-101	343	949	0.236	0.264	NLR9A_MOUSE NACHT, LRR and PYD domains-containing protein 9A OS=Mus musculus OX=10090 GN=Nlrp9a PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00004 AAA	20	17.0	ATPase family associated with various cellular activities (AAA)
2	PF13191 AAA_16	0.018	26.9	AAA ATPase domain
3	PF13401 AAA_22	3.9	19.2	AAA domain
4	PF13479 AAA_24	48	15.1	AAA domain
5	PF13481 AAA_25	7	17.7	AAA domain
6	PF12799 LRR_4	6.1e+02	12.3	Leucine Rich repeats (2 copies)
7	PF13516 LRR_6	2e-07	41.5	Leucine Rich repeat
8	PF05729 NACHT	2.4e-42	156.2	NACHT domain
9	PF00931 NB-ARC	13	16.4	NB-ARC domain
10	PF17776 NLRC4_HD2	2.2e-14	65.6	NLRC4 helical domain HD2
11	PF17779 NOD2_WH	1.6e-09	49.2	NOD2 winged helix domain
12	PF02758 PYRIN	8.1e-16	69.3	PAAD/DAPIN/Pyrin domain
13	PF00910 RNA_helicase	55	15.6	RNA helicase
14	PF05496 RuvB_N	4.1e+02	12.1	Holliday junction DNA helicase RuvB P-loop domain
15	PF05272 VirE	96	13.8	Virulence-associated protein E

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000445135

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000433138	0.862	Caspase-1
2	9606.ENSP00000247470	0.825	Apoptosis-associated speck-like protein containing a CARD
3	9606.ENSP00000376849	0.811	Caspase-5
4	9606.ENSP00000219596	0.797	Pyrin
5	9606.ENSP00000375767	0.771	Caspase recruitment domain-containing protein 8
6	9606.ENSP00000394049	0.752	Src-like-adapter
7	9606.ENSP00000359392	0.739	KHDC3-like protein
8	9606.ENSP00000355231	0.664	Beclin-1
9	9606.ENSP00000357112	0.645	Interferon-inducible protein AIM2
10	9606.ENSP00000330696	0.638	P2X purinoceptor 7
11	9606.ENSP00000364858	0.629	Caspase recruitment domain-containing protein 16
12	9606.ENSP00000227638	0.600	Pannexin-1
13	9606.ENSP00000280357	0.597	Interleukin-18
14	9606.ENSP00000262866	0.590	Src-like-adapter 2
15	9606.ENSP00000218068	0.575	Intrinsically disordered protein that potentiates the transcriptional activator activity of JUN (PubMed:24263171, PubMed:28289210). Protects cells from stress-induced apoptosis by inhibiting reactive oxygen species (ROS) production and via regulation of the MAPK signaling pathway (PubMed:21357425, PubMed:25374899, PubMed:30658679). ECO:0000269\|PubMed:24263171, ECO:0000269\|PubMed:25374899,
16	9606.ENSP00000368927	0.567	Eukaryotic translation initiation factor 1A, X-chromosomal
17	9606.ENSP00000263341	0.563	Interleukin-1 beta
18	9606.ENSP00000418259	0.563	ZFP57 zinc finger protein
19	9606.ENSP00000359668	0.562	Transcription cofactor vestigial-like protein 1
20	9606.ENSP00000359424	0.560	Inhibitor of nuclear factor kappa-B kinase subunit alpha

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.998	protein binding
GO:0019904	0.941	protein domain specific binding
GO:0097159	0.443	organic cyclic compound binding
GO:1901363	0.442	heterocyclic compound binding
GO:0016787	0.360	hydrolase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.995	regulation of biological process
GO:0080090	0.994	regulation of primary metabolic process
GO:0051171	0.994	regulation of nitrogen compound metabolic process
GO:0050794	0.987	regulation of cellular process
GO:0010468	0.987	regulation of gene expression
GO:0065009	0.977	regulation of molecular function
GO:0009893	0.975	positive regulation of metabolic process
GO:0031323	0.969	regulation of cellular metabolic process
GO:0010604	0.968	positive regulation of macromolecule metabolic process
GO:0001817	0.967	regulation of cytokine production
GO:0043281	0.966	regulation of cysteine-type endopeptidase activity involved in apoptotic process
GO:0032651	0.952	regulation of interleukin-1 beta production
GO:0044092	0.939	negative regulation of molecular function
GO:0032732	0.933	positive regulation of interleukin-1 production
GO:0051090	0.931	regulation of DNA-binding transcription factor activity
GO:0009987	0.923	cellular process
GO:0032731	0.917	positive regulation of interleukin-1 beta production
GO:0045862	0.916	positive regulation of proteolysis
GO:2001056	0.914	positive regulation of cysteine-type endopeptidase activity
GO:0050896	0.900	response to stimulus
GO:0043280	0.882	positive regulation of cysteine-type endopeptidase activity involved in apoptotic process
GO:0032088	0.786	negative regulation of NF-kappaB transcription factor activity
GO:0051716	0.718	cellular response to stimulus
GO:0048522	0.602	positive regulation of cellular process
GO:0048519	0.513	negative regulation of biological process
GO:0048583	0.487	regulation of response to stimulus
GO:0042221	0.459	response to chemical
GO:0009605	0.456	response to external stimulus
GO:0044419	0.447	biological process involved in interspecies interaction between organisms
GO:0010033	0.446	response to organic substance
GO:0006950	0.439	response to stress
GO:0009607	0.436	response to biotic stimulus
GO:0071704	0.432	organic substance metabolic process
GO:0051707	0.429	response to other organism
GO:0070887	0.425	cellular response to chemical stimulus
GO:0071310	0.359	cellular response to organic substance
GO:0006952	0.350	defense response
GO:0006807	0.325	nitrogen compound metabolic process
GO:0010646	0.321	regulation of cell communication
GO:0048523	0.321	negative regulation of cellular process
GO:0023051	0.319	regulation of signaling
GO:0044238	0.318	primary metabolic process
GO:0009966	0.308	regulation of signal transduction
GO:0048584	0.301	positive regulation of response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0012505	0.995	endomembrane system
GO:0005794	0.919	Golgi apparatus
GO:0032991	0.884	protein-containing complex
GO:0005634	0.842	nucleus
GO:0043228	0.688	non-membrane-bounded organelle
GO:0043232	0.609	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.-.-.-	0.360	Hydrolases.

[back to server]