StarFunc result for job id Q9NX05

User Input

>input (1096 residues)
MGVQGFQEFLEKRCPGAVVPVDLLKLARTVSRQQQQQHLHRQLPPTAALAPGAPRAARGS
VPLQPPLPPAALGAYSGGAGPIRHHHPAHHFHHHGQAQPGLHPPLPPPPPPQLPGARVLV
DAGSALPRLYGGYQTDWVCGGQWNAMLGYLSALCQACAYPGGDGLELVVMFPGGLGKDRL
AEWGRRCQAERQTAQLIVGHVGNKGTPPPRAWFLPPACLSHCVRLALIRFRVKVFQSLED
HHLEVVAFFRENGFHGLLAHDSEYALYNIPSYYSSHALKLSWNGKNLTTNQFLMQEVAKQ
LGLKRMNFPIFAALLGNHILPDEDLAAFHWSLLGPEHPLASLKVRAHQLVLPPCDVVIKA
VSEYVSSIKDPSNLDVVGKDVFKQSQSRTEDKIERFKKAVEYYSVTTKLSSLPVGPSFLG
FRNNRLGNPPLPRNQVGTISAGKPMFSHQVPQKVKYPPPFPVGPNSSLLFSSHALGESHA
FSEDPMLQNSPFANWAVSYDSSASQFPNYLPSKASPPLGPDSSHSSSSDGDEPNGASSDH
ITEAFHHQPEWGNPNRDRGSWAQPVDTGVSEASLGDGEPHIPSLLSMSTRNHMDITIPPL
PPVAPEVLRVAEHRHRRGLMYPYIYHVLTKGEIKIPVCIEDECNMELPPAALLFRSARQY
VYGVLFSLAETQRKMERLAMRRRLPVEVPSVILKEWSAYKGKSPQTPELVSALTFREWTC
PNLKKLWLGKAVEDKNRRMRAFLACMKSDTPSMLNPANVPTHLLLMCCVLRYMVQWPGGR
ILHRHELDTFLAQAVSTQLYEPDRLQELKIEKLDARGIQLAALFMSGVDTALFANDACGQ
PVPWEHCCPWIYFDGKLFQSKLIKAGRERVSLVELCDGQADLATKVEKMRQSILEGVNMN
HPPPSALLPSPTFVPPMVPSLYPVSLYSRAMGSMPLPPQGRSRGFAGLHPIPPQGGKLEI
AGMVVGQWAGSRSSRGRGSFGMQVVSVGGPGKGHGKEQTGRGSKGHKKGNKQGSSDGVSK
SLELHQGRSRSQVNGNSGALIKEEKSDHRLPAPSQCALSRDSNECNNGNRYLPMNNREKN
HLQEQKLETVAQRKED

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9NX05	0.999	0.999	0.000	1096	1.000	1.000	Q9NX05.pdb.gz	F120C_HUMAN Constitutive coactivator of PPAR-gamma-like protein 2 OS=Homo sapiens OX=9606 GN=FAM120C PE=1 SV=4
2	PDB:1ul1Z	0.144	0.377	4.717E-4	349	0.050	0.158	1ul1Z.pdb.gz	Structural basis for recruitment of human flap endonuclease 1 to PCNA
3	PDB:1ul1X	0.105	0.302	7.546E-4	313	0.042	0.147	1ul1X.pdb.gz	Structural basis for recruitment of human flap endonuclease 1 to PCNA
4	AFDB:Q9USK8	0.053	0.030	3.513E-2	2410	0.095	0.043	Q9USK8.pdb.gz	AGS1_SCHPO Cell wall alpha-1,3-glucan synthase ags1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ags1 PE=1 SV=3
5	AFDB:Q86SQ0	0.037	0.034	1.378E-1	1253	0.106	0.093	Q86SQ0.pdb.gz	PHLB2_HUMAN Pleckstrin homology-like domain family B member 2 OS=Homo sapiens OX=9606 GN=PHLDB2 PE=1 SV=2
6	AFDB:E3W994	0.073	0.065	1.706E-1	1273	0.129	0.111	E3W994.pdb.gz	E3W994_HUMAN Cytoplasmic linker associated protein 2 OS=Homo sapiens OX=9606 GN=CLASP2 PE=1 SV=2
7	AFDB:O94294	0.053	0.060	1.780E-1	886	0.081	0.100	O94294.pdb.gz	SOG2_SCHPO Leucine-rich repeat-containing protein sog2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=sog2 PE=1 SV=1
8	AFDB:P49750	0.042	0.029	2.023E-1	2146	0.107	0.055	P49750.pdb.gz	YLPM1_HUMAN YLP motif-containing protein 1 OS=Homo sapiens OX=9606 GN=YLPM1 PE=1 SV=4
9	AFDB:Q5BLK4	0.054	0.047	2.023E-1	1491	0.099	0.073	Q5BLK4.pdb.gz	TUT7_MOUSE Terminal uridylyltransferase 7 OS=Mus musculus OX=10090 GN=Tut7 PE=1 SV=3
10	AFDB:Q5VYS8	0.050	0.046	2.400E-1	1495	0.099	0.072	Q5VYS8.pdb.gz	TUT7_HUMAN Terminal uridylyltransferase 7 OS=Homo sapiens OX=9606 GN=TUT7 PE=1 SV=1
11	AFDB:Q7Z460	0.084	0.070	2.972E-1	1538	0.136	0.097	Q7Z460.pdb.gz	CLAP1_HUMAN CLIP-associating protein 1 OS=Homo sapiens OX=9606 GN=CLASP1 PE=1 SV=1
12	AFDB:Q8CGF1	0.069	0.064	3.840E-1	1266	0.121	0.105	Q8CGF1.pdb.gz	RHG29_MOUSE Rho GTPase-activating protein 29 OS=Mus musculus OX=10090 GN=Arhgap29 PE=1 SV=1
13	PDB:4qlbD	0.068	0.101	4.020E-1	651	0.036	0.061	4qlbD.pdb.gz
14	PDB:7f6hA	0.046	0.099	7.961E-1	305	0.031	0.111	7f6hA.pdb.gz	Cryo-EM structures of human bradykinin receptor-G q proteins complexes.
15	PDB:2bneB	0.065	0.201	1.120	238	0.025	0.113	2bneB.pdb.gz	Structure of Escherichia Coli Ump Kinase Differs from that of Other Nucleoside Monophosphate Kinases and Sheds New Light on Enzyme Regulation.
16	PDB:1ho4A	0.058	0.143	1.387	242	0.037	0.169	1ho4A.pdb.gz	Structural basis for the function of pyridoxine 5'-phosphate synthase.
17	PDB:4i6jA	0.071	0.139	1.645	503	0.033	0.072	4i6jA.pdb.gz
18	PDB:2d57A	0.046	0.124	1.717	224	0.034	0.165	2d57A.pdb.gz
19	PDB:2iw3B	0.041	0.044	1.952	980	0.025	0.028	2iw3B.pdb.gz	Structure of Eef3 and the Mechanism of Transfer RNA Release from the E-Site.
20	PDB:5dqzB	0.061	0.153	1.952	301	0.033	0.120	5dqzB.pdb.gz	Structural and Mechanistic Basis of PAM-Dependent Spacer Acquisition in CRISPR-Cas Systems.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9NX05	0.0	2254	1096	1.000	1.000	F120C_HUMAN Constitutive coactivator of PPAR-gamma-like protein 2 OS=Homo sapiens OX=9606 GN=FAM120C PE=1 SV=4
2	Q9NZB2	0.0	1034	1118	0.548	0.538	F120A_HUMAN Constitutive coactivator of PPAR-gamma-like protein 1 OS=Homo sapiens OX=9606 GN=FAM120A PE=1 SV=2
3	A0A0C4DH52	6.25e-147	451	495	0.245	0.543	A0A0C4DH52_HUMAN Family with sequence similarity 120A (Fragment) OS=Homo sapiens OX=9606 GN=FAM120A PE=1 SV=1
4	Q6RI63	2.43e-49	191	786	0.179	0.249	F120B_MOUSE Constitutive coactivator of peroxisome proliferator-activated receptor gamma OS=Mus musculus OX=10090 GN=Fam120b PE=1 SV=1
5	A0A494C0Y9	5.81e-44	163	280	0.092	0.361	A0A494C0Y9_HUMAN Family with sequence similarity 120A (Fragment) OS=Homo sapiens OX=9606 GN=FAM120A PE=1 SV=1
6	Q96EK7	8.67e-26	117	910	0.074	0.089	F120B_HUMAN Constitutive coactivator of peroxisome proliferator-activated receptor gamma OS=Homo sapiens OX=9606 GN=FAM120B PE=1 SV=1
7	Q61382	0.040	40.0	470	0.021	0.049	TRAF4_MOUSE TNF receptor-associated factor 4 OS=Mus musculus OX=10090 GN=Traf4 PE=1 SV=2
8	Q9BUZ4	0.042	40.0	470	0.021	0.049	TRAF4_HUMAN TNF receptor-associated factor 4 OS=Homo sapiens OX=9606 GN=TRAF4 PE=1 SV=1
9	P83780	0.47	37.0	550	0.028	0.056	G6PI_CANAL Glucose-6-phosphate isomerase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=PGI1 PE=1 SV=2
10	G5EGJ9	2.8	34.7	1367	0.019	0.015	DEP1_CAEEL Receptor-type tyrosine-protein phosphatase dep-1 OS=Caenorhabditis elegans OX=6239 GN=dep-1 PE=1 SV=1
11	Q7T1K2	5.8	33.1	470	0.017	0.040	Q7T1K2_DANRE TNF receptor-associated factor OS=Danio rerio OX=7955 GN=traf4l PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000364324

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000346667	0.774	Serine/threonine-protein kinase WNK3
2	9606.ENSP00000350676	0.733	Histone lysine demethylase PHF8
3	9606.ENSP00000479716	0.710	DnaJ homolog subfamily C member 28
4	9606.ENSP00000357051	0.675	Peroxisomal biogenesis factor 19
5	9606.ENSP00000304553	0.674	M-phase-specific PLK1-interacting protein
6	9606.ENSP00000347978	0.648	DNA repair protein complementing XP-G cells
7	9606.ENSP00000481038	0.623	Cytoplasmic FMR1-interacting protein 1
8	9606.ENSP00000160373	0.603	Cortactin-binding protein 2
9	9606.ENSP00000338475	0.595	Succinate--hydroxymethylglutarate CoA-transferase
10	9606.ENSP00000475615	0.565	Spliceosome-associated protein CWC15 homolog
11	9606.ENSP00000350673	0.556	Protein FAM3B
12	9606.ENSP00000369853	0.556	C2 calcium dependent domain containing 2
13	9606.ENSP00000211413	0.553	Interferon induced transmembrane protein domain containing
14	9606.ENSP00000234831	0.544	Transmembrane protein 59

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003723	1.000	RNA binding
GO:0005515	0.393	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.995	regulation of biological process
GO:0050794	0.993	regulation of cellular process
GO:0009987	0.991	cellular process
GO:0051716	0.962	cellular response to stimulus
GO:0048522	0.849	positive regulation of cellular process
GO:0051171	0.769	regulation of nitrogen compound metabolic process
GO:0060255	0.766	regulation of macromolecule metabolic process
GO:0031323	0.702	regulation of cellular metabolic process
GO:0080090	0.690	regulation of primary metabolic process
GO:0032502	0.648	developmental process
GO:0071704	0.612	organic substance metabolic process
GO:0044237	0.606	cellular metabolic process
GO:0044238	0.602	primary metabolic process
GO:0006807	0.548	nitrogen compound metabolic process
GO:0007154	0.533	cell communication
GO:0023052	0.529	signaling
GO:0048519	0.472	negative regulation of biological process
GO:0043170	0.470	macromolecule metabolic process
GO:0007165	0.430	signal transduction
GO:0009893	0.428	positive regulation of metabolic process
GO:0031325	0.420	positive regulation of cellular metabolic process
GO:0071840	0.416	cellular component organization or biogenesis
GO:0048523	0.414	negative regulation of cellular process
GO:0016043	0.375	cellular component organization
GO:0046483	0.370	heterocycle metabolic process
GO:0006725	0.356	cellular aromatic compound metabolic process
GO:1901360	0.343	organic cyclic compound metabolic process
GO:0034641	0.343	cellular nitrogen compound metabolic process
GO:0006139	0.334	nucleobase-containing compound metabolic process
GO:0030154	0.308	cell differentiation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.998	cytosol
GO:0016020	0.989	membrane
GO:0043229	0.887	intracellular organelle
GO:0070013	0.807	intracellular organelle lumen
GO:0043231	0.780	intracellular membrane-bounded organelle
GO:0031981	0.770	nuclear lumen
GO:0005654	0.597	nucleoplasm
GO:0043232	0.335	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]