StarFunc result for job id Q9NX07

User Input

>input (287 residues)
MAASLWMGDLEPYMDENFISRAFATMGETVMSVKIIRNRLTGIPAGYCFVEFADLATAEK
CLHKINGKPLPGATPAKRFKLNYATYGKQPDNSPEYSLFVGDLTPDVDDGMLYEFFVKVY
PSCRGGKVVLDQTGVSKGYGFVKFTDELEQKRALTECQGAVGLGSKPVRLSVAIPKASRV
KPVEYSQMYSYSYNQYYQQYQNYYAQWGYDQNTGSYSYSYPQYGYTQSTMQTYEEVGDDA
LEDPMPQLDVTEANKEFMEQSEELYDALMDCHWQPLDTVSSEIPAMM

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q80VC6	0.671	0.671	2.882E-54	287	0.990	0.990	Q80VC6.pdb.gz	TSAP1_MOUSE tRNA selenocysteine 1-associated protein 1 OS=Mus musculus OX=10090 GN=Trnau1ap PE=1 SV=2
2	AFDB:Q8VXZ9	0.444	0.319	2.119E-21	425	0.383	0.259	Q8VXZ9.pdb.gz	R47BP_ARATH Polyadenylate-binding protein RBP47B' OS=Arabidopsis thaliana OX=3702 GN=RBP47B' PE=2 SV=1
3	AFDB:Q9SAB3	0.477	0.354	4.938E-21	405	0.359	0.254	Q9SAB3.pdb.gz	RB45B_ARATH Polyadenylate-binding protein RBP45B OS=Arabidopsis thaliana OX=3702 GN=RBP45B PE=1 SV=1
4	AFDB:O60176	0.302	0.186	6.289E-21	473	0.328	0.199	O60176.pdb.gz	YG41_SCHPO Uncharacterized RNA-binding protein C23E6.01c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC23E6.01c PE=1 SV=2
5	AFDB:Q0J9Y2	0.428	0.310	2.238E-20	425	0.296	0.200	Q0J9Y2.pdb.gz	RBPL_ORYSJ RNA-binding protein L OS=Oryza sativa subsp. japonica OX=39947 GN=RBP-L PE=1 SV=1
6	AFDB:Q9LEB3	0.372	0.268	3.028E-20	428	0.310	0.208	Q9LEB3.pdb.gz	RBP47_NICPL Polyadenylate-binding protein RBP47 OS=Nicotiana plumbaginifolia OX=4092 GN=RBP47 PE=1 SV=1
7	AFDB:Q9LEB4	0.404	0.299	3.028E-20	409	0.310	0.218	Q9LEB4.pdb.gz	RBP45_NICPL Polyadenylate-binding protein RBP45 OS=Nicotiana plumbaginifolia OX=4092 GN=RBP45 PE=1 SV=1
8	AFDB:Q5ARJ0	0.313	0.235	4.351E-20	393	0.324	0.237	Q5ARJ0.pdb.gz	Q5ARJ0_EMENI RRM domain-containing protein OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_09090 PE=4 SV=1
9	AFDB:Q9SX80	0.352	0.254	1.856E-19	434	0.293	0.194	Q9SX80.pdb.gz	R47CP_ARATH Polyadenylate-binding protein RBP47C' OS=Arabidopsis thaliana OX=3702 GN=RBP47C' PE=2 SV=1
10	AFDB:F4I3B3	0.352	0.247	5.853E-19	445	0.303	0.196	F4I3B3.pdb.gz	RB47A_ARATH Polyadenylate-binding protein RBP47A OS=Arabidopsis thaliana OX=3702 GN=RBP47A PE=2 SV=1
11	PDB:7oqcF	0.261	0.279	8.561E-11	267	0.157	0.169	7oqcF.pdb.gz	Structural insights into how Prp5 proofreads the pre-mRNA branch site.
12	PDB:6y53o	0.253	0.440	4.651E-10	160	0.164	0.294	6y53o.pdb.gz	Molecular architecture of the human 17S U2 snRNP.
13	PDB:6r5kH	0.356	0.278	4.625E-9	394	0.181	0.132	6r5kH.pdb.gz	Molecular Basis for poly(A) RNP Architecture and Recognition by the Pan2-Pan3 Deadenylase.
14	PDB:5lsbA	0.243	0.382	6.647E-9	176	0.098	0.159	5lsbA.pdb.gz
15	PDB:5vsuA	0.244	0.184	1.072E-7	387	0.111	0.083	5vsuA.pdb.gz	Architecture of the U6 snRNP reveals specific recognition of 3'-end processed U6 snRNA.
16	PDB:6qw6R	0.271	0.693	2.339E-6	106	0.108	0.292	6qw6R.pdb.gz	Mechanism of 5' splice site transfer for human spliceosome activation.
17	PDB:6ff7X	0.223	0.355	9.977E-6	171	0.105	0.175	6ff7X.pdb.gz	Structure and Conformational Dynamics of the Human Spliceosomal BactComplex.
18	PDB:5yzg1	0.243	0.284	1.060E-5	243	0.122	0.144	5yzg1.pdb.gz	Structure of a human catalytic step I spliceosome
19	PDB:6gd1A	0.257	0.383	3.146E-5	190	0.080	0.121	6gd1A.pdb.gz
20	PDB:7evoD	0.247	0.345	3.342E-5	200	0.094	0.135	7evoD.pdb.gz	Structural Insights into Branch Site Proofreading by Human Spliceosome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q80VC6	0.0	590	287	0.990	0.990	TSAP1_MOUSE tRNA selenocysteine 1-associated protein 1 OS=Mus musculus OX=10090 GN=Trnau1ap PE=1 SV=2
2	Q9NX07	0.0	598	287	1.000	1.000	TSAP1_HUMAN tRNA selenocysteine 1-associated protein 1 OS=Homo sapiens OX=9606 GN=TRNAU1AP PE=1 SV=1
3	Q9QZI7	0.0	593	287	0.993	0.993	TSAP1_RAT tRNA selenocysteine 1-associated protein 1 OS=Rattus norvegicus OX=10116 GN=Trnau1ap PE=1 SV=1
4	O60176	2.21e-47	166	473	0.324	0.197	YG41_SCHPO Uncharacterized RNA-binding protein C23E6.01c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC23E6.01c PE=1 SV=2
5	Q8VXZ9	2.10e-46	162	425	0.296	0.200	R47BP_ARATH Polyadenylate-binding protein RBP47B' OS=Arabidopsis thaliana OX=3702 GN=RBP47B' PE=2 SV=1
6	Q9SAB3	6.83e-46	161	405	0.303	0.215	RB45B_ARATH Polyadenylate-binding protein RBP45B OS=Arabidopsis thaliana OX=3702 GN=RBP45B PE=1 SV=1
7	Q93W34	3.20e-45	159	415	0.300	0.207	RP45C_ARATH Polyadenylate-binding protein RBP45C OS=Arabidopsis thaliana OX=3702 GN=RBP45C PE=2 SV=1
8	Q9FPJ8	4.42e-44	155	387	0.293	0.217	RB45A_ARATH Polyadenylate-binding protein RBP45A OS=Arabidopsis thaliana OX=3702 GN=RBP45A PE=2 SV=1
9	Q9LEB3	1.21e-43	155	428	0.300	0.201	RBP47_NICPL Polyadenylate-binding protein RBP47 OS=Nicotiana plumbaginifolia OX=4092 GN=RBP47 PE=1 SV=1
10	Q9LEB4	1.51e-43	155	409	0.321	0.225	RBP45_NICPL Polyadenylate-binding protein RBP45 OS=Nicotiana plumbaginifolia OX=4092 GN=RBP45 PE=1 SV=1
11	Q0J9Y2	7.01e-43	153	425	0.289	0.195	RBPL_ORYSJ RNA-binding protein L OS=Oryza sativa subsp. japonica OX=39947 GN=RBP-L PE=1 SV=1
12	Q9SX80	1.40e-42	153	434	0.272	0.180	R47CP_ARATH Polyadenylate-binding protein RBP47C' OS=Arabidopsis thaliana OX=3702 GN=RBP47C' PE=2 SV=1
13	Q5ARJ0	1.60e-42	152	393	0.303	0.221	Q5ARJ0_EMENI RRM domain-containing protein OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_09090 PE=4 SV=1
14	Q0WW84	1.75e-42	152	435	0.286	0.189	RB47B_ARATH Polyadenylate-binding protein RBP47B OS=Arabidopsis thaliana OX=3702 GN=RBP47B PE=1 SV=1
15	Q9SX79	4.77e-42	151	432	0.272	0.181	RB47C_ARATH Polyadenylate-binding protein RBP47C OS=Arabidopsis thaliana OX=3702 GN=RBP47C PE=2 SV=1
16	F4I3B3	1.99e-41	150	445	0.282	0.182	RB47A_ARATH Polyadenylate-binding protein RBP47A OS=Arabidopsis thaliana OX=3702 GN=RBP47A PE=2 SV=1
17	O13759	9.37e-41	151	632	0.286	0.130	CSX1_SCHPO RNA-binding post-transcriptional regulator csx1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=csx1 PE=1 SV=1
18	Q00539	8.69e-28	114	523	0.261	0.143	NAM8_YEAST Protein NAM8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=NAM8 PE=1 SV=2
19	Q9LQI9	2.06e-21	95.1	419	0.213	0.146	UBP1B_ARATH Oligouridylate-binding protein 1B OS=Arabidopsis thaliana OX=3702 GN=UBP1B PE=1 SV=1
20	P04147	1.15e-19	90.9	577	0.199	0.099	PABP_YEAST Polyadenylate-binding protein, cytoplasmic and nuclear OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PAB1 PE=1 SV=4

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00076 RRM_1	2e-23	93.3	RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
2	PF17654 Trnau1ap	5.3e-35	132.2	Selenocysteine tRNA 1 associated proteins

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 132908.ENSPVAP00000016239

Rank	PPI partner	STRING score	Description
1	132908.ENSPVAP00000014900	0.991	pre-mRNA processing factor 39
2	132908.ENSPVAP00000009024	0.980	Small nuclear ribonucleoprotein 70kDa (U1)
3	132908.ENSPVAP00000014705	0.974	Small nuclear ribonucleoprotein polypeptide C
4	132908.ENSPVAP00000010754	0.964	Small nuclear ribonucleoprotein D3 polypeptide 18kDa
5	132908.ENSPVAP00000007842	0.961	Splicing factor 3b, subunit 1, 155kDa
6	132908.ENSPVAP00000000647	0.956	Splicing factor 3b, subunit 3, 130kDa
7	132908.ENSPVAP00000005215	0.950	Small nuclear ribonucleoprotein D1 polypeptide 16kDa
8	132908.ENSPVAP00000001264	0.944	Small nuclear ribonucleoprotein D2 polypeptide 16.5kDa
9	132908.ENSPVAP00000004595	0.943	Small nuclear ribonucleoprotein polypeptide G
10	132908.ENSPVAP00000008523	0.942	Small nuclear ribonucleoprotein polypeptide F
11	132908.ENSPVAP00000013354	0.939	Splicing factor 3b, subunit 4, 49kDa
12	132908.ENSPVAP00000004298	0.931	U2 small nuclear RNA auxiliary factor 2
13	132908.ENSPVAP00000000509	0.923	LUC7-like (S. cerevisiae)
14	132908.ENSPVAP00000012233	0.923	annotation not available
15	132908.ENSPVAP00000004560	0.922	PRP40 pre-mRNA processing factor 40 homolog A (S. cerevisiae)
16	132908.ENSPVAP00000014973	0.922	PRP40 pre-mRNA processing factor 40 homolog B (S. cerevisiae)
17	132908.ENSPVAP00000003844	0.906	Small nuclear ribonucleoprotein polypeptide N
18	132908.ENSPVAP00000016049	0.906	Small nuclear ribonucleoprotein polypeptides B and B1
19	132908.ENSPVAP00000016716	0.900	Splicing factor 3a, subunit 1, 120kDa
20	132908.ENSPVAP00000009578	0.893	Splicing factor 3a, subunit 3, 60kDa

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003723	1.000	RNA binding
GO:0003729	0.898	mRNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.987	cellular process
GO:0050789	0.981	regulation of biological process
GO:0071704	0.974	organic substance metabolic process
GO:0044237	0.972	cellular metabolic process
GO:0044238	0.971	primary metabolic process
GO:0019222	0.970	regulation of metabolic process
GO:0050794	0.932	regulation of cellular process
GO:0060255	0.924	regulation of macromolecule metabolic process
GO:0010468	0.907	regulation of gene expression
GO:0006807	0.903	nitrogen compound metabolic process
GO:0031323	0.895	regulation of cellular metabolic process
GO:0080090	0.891	regulation of primary metabolic process
GO:0051171	0.890	regulation of nitrogen compound metabolic process
GO:0043170	0.850	macromolecule metabolic process
GO:0010467	0.791	gene expression
GO:0034641	0.782	cellular nitrogen compound metabolic process
GO:0006417	0.709	regulation of translation
GO:0044260	0.695	cellular macromolecule metabolic process
GO:1901564	0.675	organonitrogen compound metabolic process
GO:1901576	0.660	organic substance biosynthetic process
GO:0044249	0.660	cellular biosynthetic process
GO:0019538	0.657	protein metabolic process
GO:0016070	0.649	RNA metabolic process
GO:0009059	0.635	macromolecule biosynthetic process
GO:0044271	0.582	cellular nitrogen compound biosynthetic process
GO:0006412	0.535	translation
GO:0006396	0.453	RNA processing
GO:0016071	0.399	mRNA metabolic process
GO:0006414	0.371	translational elongation
GO:0006397	0.335	mRNA processing

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0031981	0.960	nuclear lumen
GO:0005654	0.937	nucleoplasm
GO:0032991	0.870	protein-containing complex
GO:0005737	0.854	cytoplasm
GO:1990904	0.595	ribonucleoprotein complex
GO:0005829	0.414	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]