StarFunc result for job id Q9NX09

User Input

>input (232 residues)
MPSLWDRFSSSSTSSSPSSLPRTPTPDRPPRSAWGSATREEGFDRSTSLESSDCESLDSS
NSGFGPEEDTAYLDGVSLPDFELLSDPEDEHLCANLMQLLQESLAQARLGSRRPARLLMP
SQLVSQVGKELLRLAYSEPCGLRGALLDVCVEQGKSCHSVGQLALDPSLVPTFQLTLVLR
LDSRLWPKIQGLFSSANSPFLPGFSQSLTLSTGFRVIKKKLYSSEQLLIEEC

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A024QZQ6	0.722	0.722	8.953E-43	232	1.000	1.000	A0A024QZQ6.pdb.gz
2	AFDB:Q7T346	0.563	0.591	4.117E-22	220	0.435	0.459	Q7T346.pdb.gz	DDIT4_DANRE DNA damage-inducible transcript 4 protein OS=Danio rerio OX=7955 GN=ddit4 PE=2 SV=1
3	AFDB:Q96D03	0.524	0.622	2.064E-16	193	0.280	0.337	Q96D03.pdb.gz	DDT4L_HUMAN DNA damage-inducible transcript 4-like protein OS=Homo sapiens OX=9606 GN=DDIT4L PE=1 SV=1
4	AFDB:Q9VTH4	0.485	0.408	2.836E-12	280	0.220	0.182	Q9VTH4.pdb.gz	SCLLA_DROME Protein scylla OS=Drosophila melanogaster OX=7227 GN=scyl PE=2 SV=1
5	AFDB:Q9VTI8	0.471	0.374	4.411E-12	299	0.203	0.157	Q9VTI8.pdb.gz	CHRB_DROME Protein charybde OS=Drosophila melanogaster OX=7227 GN=chrb PE=2 SV=2
6	AFDB:A0MWD1	0.145	0.067	1.518E-2	710	0.147	0.048	A0MWD1.pdb.gz	MX2_BUBBU Interferon-induced GTP-binding protein Mx2 OS=Bubalus bubalis OX=89462 GN=MX2 PE=2 SV=1
7	AFDB:Q6NPM8	0.180	0.137	2.437E-1	346	0.103	0.069	Q6NPM8.pdb.gz	HIS7_ARATH Bifunctional phosphatase IMPL2, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=HISN7 PE=1 SV=1
8	PDB:1bk4A	0.162	0.132	2.862E-1	314	0.069	0.051	1bk4A.pdb.gz	Structure of rabbit liver fructose 1,6-bisphosphatase at 2.3 A resolution.
9	PDB:5oeyC	0.154	0.121	4.741E-1	326	0.047	0.034	5oeyC.pdb.gz	Structures of Leishmania Fructose-1,6-Bisphosphatase Reveal Species-Specific Differences in the Mechanism of Allosteric Inhibition.
10	PDB:5k55A	0.148	0.125	5.050E-1	290	0.039	0.031	5k55A.pdb.gz	Structure of E69Q mutant of human muscle fructose-1,6-bisphosphatase.
11	PDB:5oeyD	0.150	0.124	5.379E-1	301	0.060	0.047	5oeyD.pdb.gz	Structures of Leishmania Fructose-1,6-Bisphosphatase Reveal Species-Specific Differences in the Mechanism of Allosteric Inhibition.
12	PDB:7ezfD	0.170	0.129	6.102E-1	329	0.052	0.036	7ezfD.pdb.gz	Discovery of Novel Indole Derivatives as Fructose-1,6-bisphosphatase Inhibitors and X-ray Cocrystal Structures Analysis.
13	PDB:5q0cA	0.167	0.127	7.854E-1	328	0.034	0.024	5q0cA.pdb.gz	Human liver fructose-1,6-bisphosphatase 1 (fructose 1,6-bisphosphate 1-phosphatase, E.C.3.1.3.11) complexed with the allosteric inhibitor 1-(5-bromo-1,3-thiazol-2-yl)-3-[5-(4-methoxyphenyl)thiophen-2-yl]sulfonylurea and with f2,6p
14	AFDB:P39925	0.107	0.046	1.040	761	0.147	0.045	P39925.pdb.gz	AFG3_YEAST Mitochondrial respiratory chain complexes assembly protein AFG3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=AFG3 PE=1 SV=1
15	PDB:3ssmB	0.108	0.078	1.077	354	0.047	0.031	3ssmB.pdb.gz	A new structural form in the SAM/metal-dependent o‑methyltransferase family: MycE from the mycinamicin biosynthetic pathway.
16	AFDB:Q07821	0.101	0.096	1.108	250	0.129	0.120	Q07821.pdb.gz	ISA1_YEAST Iron-sulfur assembly protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ISA1 PE=1 SV=1
17	PDB:3ssoB	0.106	0.071	1.147	394	0.047	0.028	3ssoB.pdb.gz	A new structural form in the SAM/metal-dependent o‑methyltransferase family: MycE from the mycinamicin biosynthetic pathway.
18	PDB:4hfqA	0.100	0.111	1.301	203	0.095	0.108	4hfqA.pdb.gz
19	AFDB:Q9H0K6	0.111	0.041	1.519	701	0.095	0.031	Q9H0K6.pdb.gz	PUS7L_HUMAN Pseudouridylate synthase PUS7L OS=Homo sapiens OX=9606 GN=PUS7L PE=1 SV=1
20	PDB:4y9jB	0.152	0.080	1.675	593	0.082	0.032	4y9jB.pdb.gz	Acyl-CoA Dehydrogenase Drives Heat Adaptation by Sequestering Fatty Acids

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9NX09	1.24e-165	457	232	1.000	1.000	DDIT4_HUMAN DNA damage-inducible transcript 4 protein OS=Homo sapiens OX=9606 GN=DDIT4 PE=1 SV=1
2	Q9D3F7	3.50e-144	403	229	0.914	0.926	DDIT4_MOUSE DNA damage-inducible transcript 4 protein OS=Mus musculus OX=10090 GN=Ddit4 PE=1 SV=1
3	Q8VHZ9	1.26e-143	402	229	0.909	0.921	DDIT4_RAT DNA damage-inducible transcript 4 protein OS=Rattus norvegicus OX=10116 GN=Ddit4 PE=1 SV=1
4	Q7T346	1.51e-55	178	220	0.384	0.405	DDIT4_DANRE DNA damage-inducible transcript 4 protein OS=Danio rerio OX=7955 GN=ddit4 PE=2 SV=1
5	Q96D03	8.90e-29	108	193	0.254	0.306	DDT4L_HUMAN DNA damage-inducible transcript 4-like protein OS=Homo sapiens OX=9606 GN=DDIT4L PE=1 SV=1
6	Q9VTI8	1.69e-10	61.6	299	0.194	0.151	CHRB_DROME Protein charybde OS=Drosophila melanogaster OX=7227 GN=chrb PE=2 SV=2
7	Q9VTH4	1.14e-09	59.3	280	0.138	0.114	SCLLA_DROME Protein scylla OS=Drosophila melanogaster OX=7227 GN=scyl PE=2 SV=1
8	P26570	2.0	32.0	692	0.103	0.035	PPZ1_YEAST Serine/threonine-protein phosphatase PP-Z1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PPZ1 PE=1 SV=5
9	Q9P1A2	2.8	31.6	415	0.091	0.051	PP4RL_HUMAN Putative serine/threonine-protein phosphatase 4 regulatory subunit 1-like OS=Homo sapiens OX=9606 GN=PPP4R1L PE=5 SV=3
10	G5EBN5	4.8	30.8	1492	0.052	0.008	G5EBN5_CAEEL BRO1 domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=ego-2 PE=1 SV=1
11	H8ESG1	4.8	30.8	1494	0.052	0.008	H8ESG1_CAEEL BRO1 domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=ego-2 PE=1 SV=1
12	Q01063	5.0	30.8	747	0.095	0.029	PDE4D_MOUSE cAMP-specific 3',5'-cyclic phosphodiesterase 4D OS=Mus musculus OX=10090 GN=Pde4d PE=1 SV=2
13	A0A1D8PJV0	6.0	30.4	852	0.125	0.034	A0A1D8PJV0_CANAL Transcription factor OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MBP1 PE=4 SV=1
14	P53955	7.3	30.0	656	0.060	0.021	SLM2_YEAST Phosphatidylinositol 4,5-bisphosphate-binding protein SLM2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SLM2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07809 RTP801_C	8.5e-37	137.1	RTP801 C-terminal region

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000307305

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000462521	0.990	Thioredoxin-interacting protein
2	9606.ENSP00000219476	0.987	Tuberin
3	9606.ENSP00000298552	0.975	Hamartin
4	9606.ENSP00000361930	0.972	14-3-3 protein beta/alpha
5	9606.ENSP00000269305	0.958	Cellular tumor antigen p53
6	9606.ENSP00000379287	0.950	14-3-3 protein zeta/delta
7	9606.ENSP00000264731	0.927	Tumor protein 63
8	9606.ENSP00000340989	0.914	14-3-3 protein sigma
9	9606.ENSP00000306330	0.904	14-3-3 protein gamma
10	9606.ENSP00000248975	0.903	14-3-3 protein eta
11	9606.ENSP00000264335	0.901	14-3-3 protein epsilon
12	9606.ENSP00000371267	0.900	14-3-3 protein theta
13	9606.ENSP00000475727	0.873	TBC1 domain family member 7
14	9606.ENSP00000354558	0.703	Serine/threonine-protein kinase mTOR
15	9606.ENSP00000239223	0.685	Dual specificity protein phosphatase 1
16	9606.ENSP00000262187	0.669	GTP-binding protein Rheb
17	9606.ENSP00000225577	0.668	Ribosomal protein S6 kinase beta-1
18	9606.ENSP00000340691	0.663	Eukaryotic translation initiation factor 4E-binding protein 1
19	9606.ENSP00000363680	0.642	Ectodysplasin-A
20	9606.ENSP00000437955	0.636	Hypoxia-inducible factor 1-alpha

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050896	0.988	response to stimulus
GO:0009968	0.986	negative regulation of signal transduction
GO:0006950	0.984	response to stress
GO:1902531	0.984	regulation of intracellular signal transduction
GO:0032006	0.965	regulation of TOR signaling
GO:0009987	0.956	cellular process
GO:1902532	0.952	negative regulation of intracellular signal transduction
GO:0032007	0.922	negative regulation of TOR signaling
GO:0009605	0.735	response to external stimulus
GO:0019222	0.694	regulation of metabolic process
GO:0044419	0.663	biological process involved in interspecies interaction between organisms
GO:0140546	0.651	defense response to symbiont
GO:0009615	0.642	response to virus
GO:0051716	0.599	cellular response to stimulus
GO:0031323	0.596	regulation of cellular metabolic process
GO:0080090	0.561	regulation of primary metabolic process
GO:0048518	0.511	positive regulation of biological process
GO:0007154	0.502	cell communication
GO:0051171	0.473	regulation of nitrogen compound metabolic process
GO:0009628	0.465	response to abiotic stimulus
GO:0048522	0.441	positive regulation of cellular process
GO:0060255	0.438	regulation of macromolecule metabolic process
GO:0001666	0.374	response to hypoxia
GO:0023052	0.351	signaling
GO:0008152	0.326	metabolic process
GO:0007165	0.324	signal transduction
GO:0009892	0.314	negative regulation of metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0043231	0.696	intracellular membrane-bounded organelle
GO:0070013	0.527	intracellular organelle lumen
GO:0005634	0.480	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]