StarFunc result for job id Q9NX14

User Input

>input (153 residues)
MAAGLFGLSARRLLAAAATRGLPAARVRWESSFSRTVVAPSAVAGKRPPEPTTPWQEDPE
PEDENLYEKNPDSHGYDKDPVLDVWNMRLVFFFGVSIILVLGSTFVAYLPDYRMKEWSRR
EAERLVKYREANGLPIMESNCFDPSKIQLPEDE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q7Z4X2	0.710	0.688	4.108E-24	158	0.974	0.943	Q7Z4X2.pdb.gz	Q7Z4X2_HUMAN NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial OS=Homo sapiens OX=9606 PE=2 SV=1
2	AFDB:Q8HXG5	0.910	0.905	5.557E-23	154	0.850	0.844	Q8HXG5.pdb.gz	NDUBB_BOVIN NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial OS=Bos taurus OX=9913 GN=NDUFB11 PE=1 SV=2
3	AFDB:O09111	0.708	0.717	9.377E-19	151	0.719	0.728	O09111.pdb.gz	NDUBB_MOUSE NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial OS=Mus musculus OX=10090 GN=Ndufb11 PE=1 SV=2
4	AFDB:Q9CQ68	0.823	0.839	3.906E-16	150	0.627	0.640	Q9CQ68.pdb.gz	Q9CQ68_MOUSE NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial OS=Mus musculus OX=10090 GN=Ndufb11b PE=1 SV=1
5	PDB:7qsmg	0.592	0.878	1.950E-15	101	0.588	0.891	7qsmg.pdb.gz	Cryo-EM structures define ubiquinone-10 binding to mitochondrial complex I and conformational transitions accompanying Q-site occupancy.
6	PDB:7ak6g	0.572	0.832	3.025E-14	102	0.556	0.833	7ak6g.pdb.gz	Structural basis for a complex I mutation that blocks pathological ROS production.
7	AFDB:Q1LYN0	0.604	0.615	1.065E-11	150	0.412	0.420	Q1LYN0.pdb.gz	Q1LYN0_DANRE NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial OS=Danio rerio OX=7955 GN=im:6897973 PE=1 SV=1
8	AFDB:A8WFJ9	0.155	0.061	1.353	437	0.137	0.048	A8WFJ9.pdb.gz	ETS4_CAEEL Transcription factor ets-4 OS=Caenorhabditis elegans OX=6239 GN=ets-4 PE=1 SV=1
9	AFDB:Q9ZW05	0.183	0.174	1.353	169	0.157	0.142	Q9ZW05.pdb.gz	Q9ZW05_ARATH Transmembrane protein OS=Arabidopsis thaliana OX=3702 GN=At2g29180 PE=1 SV=1
10	AFDB:A0A1D8PTX2	0.129	0.085	1.552	301	0.137	0.070	A0A1D8PTX2.pdb.gz	A0A1D8PTX2_CANAL Cu-binding protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=SCO1 PE=3 SV=1
11	AFDB:O23137	0.174	0.094	1.662	344	0.118	0.052	O23137.pdb.gz	O23137_ARATH At1g22850/F29G20_19 OS=Arabidopsis thaliana OX=3702 GN=F29G20.19 PE=1 SV=1
12	AFDB:Q08693	0.162	0.047	1.780	809	0.118	0.022	Q08693.pdb.gz	TRE2_YEAST Putative zinc metalloprotease TRE2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TRE2 PE=1 SV=1
13	PDB:1qzeA	0.092	0.067	3.903	214	0.078	0.056	1qzeA.pdb.gz
14	PDB:5nrlA	0.154	0.018	8.884	2216	0.059	0.004	5nrlA.pdb.gz	Structure of a pre-catalytic spliceosome.
15	PDB:6rlbD	0.147	0.062	9.515	446	0.137	0.047	6rlbD.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9NX14	5.84e-111	313	153	1.000	1.000	NDUBB_HUMAN NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial OS=Homo sapiens OX=9606 GN=NDUFB11 PE=1 SV=1
2	Q7Z4X2	3.68e-98	281	158	0.967	0.937	Q7Z4X2_HUMAN NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial OS=Homo sapiens OX=9606 PE=2 SV=1
3	Q8HXG5	5.81e-96	275	154	0.850	0.844	NDUBB_BOVIN NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial OS=Bos taurus OX=9913 GN=NDUFB11 PE=1 SV=2
4	O09111	1.71e-81	238	151	0.765	0.775	NDUBB_MOUSE NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial OS=Mus musculus OX=10090 GN=Ndufb11 PE=1 SV=2
5	Q9CQ68	4.61e-53	166	150	0.627	0.640	Q9CQ68_MOUSE NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial OS=Mus musculus OX=10090 GN=Ndufb11b PE=1 SV=1
6	Q9D9S8	1.77e-52	165	150	0.621	0.633	Q9D9S8_MOUSE NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial OS=Mus musculus OX=10090 GN=Ndufb11b PE=2 SV=1
7	Q1LYN0	5.35e-35	120	150	0.418	0.427	Q1LYN0_DANRE NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial OS=Danio rerio OX=7955 GN=im:6897973 PE=1 SV=1
8	Q9R1X4	0.33	33.1	1197	0.105	0.013	TIM_MOUSE Protein timeless homolog OS=Mus musculus OX=10090 GN=Timeless PE=1 SV=3
9	Q86UL3	0.87	32.0	456	0.111	0.037	GPAT4_HUMAN Glycerol-3-phosphate acyltransferase 4 OS=Homo sapiens OX=9606 GN=GPAT4 PE=1 SV=1
10	P54289	1.1	31.6	1103	0.085	0.012	CA2D1_HUMAN Voltage-dependent calcium channel subunit alpha-2/delta-1 OS=Homo sapiens OX=9606 GN=CACNA2D1 PE=1 SV=3
11	P13806	1.2	31.6	1106	0.085	0.012	CA2D1_RABIT Voltage-dependent calcium channel subunit alpha-2/delta-1 OS=Oryctolagus cuniculus OX=9986 GN=CACNA2D1 PE=1 SV=1
12	Q7TNL7	1.3	31.2	452	0.105	0.035	Q7TNL7_MOUSE Dual specificity protein phosphatase OS=Mus musculus OX=10090 GN=Dusp9 PE=1 SV=1
13	P54290	1.4	31.2	1091	0.085	0.012	CA2D1_RAT Voltage-dependent calcium channel subunit alpha-2/delta-1 OS=Rattus norvegicus OX=10116 GN=Cacna2d1 PE=1 SV=1
14	O08532	1.6	31.2	1103	0.085	0.012	CA2D1_MOUSE Voltage-dependent calcium channel subunit alpha-2/delta-1 OS=Mus musculus OX=10090 GN=Cacna2d1 PE=1 SV=1
15	Q53EU6	1.7	30.8	434	0.085	0.030	GPAT3_HUMAN Glycerol-3-phosphate acyltransferase 3 OS=Homo sapiens OX=9606 GN=GPAT3 PE=1 SV=2
16	O56785	1.9	30.8	628	0.196	0.048	O56785_9CAUD Cell wall hydrolase Ply187 OS=Phietavirus pv187 OX=55511 GN=ply187 PE=4 SV=1
17	Q9NY47	2.1	30.8	1150	0.072	0.010	CA2D2_HUMAN Voltage-dependent calcium channel subunit alpha-2/delta-2 OS=Homo sapiens OX=9606 GN=CACNA2D2 PE=1 SV=2
18	Q8C0N2	2.3	30.4	438	0.078	0.027	GPAT3_MOUSE Glycerol-3-phosphate acyltransferase 3 OS=Mus musculus OX=10090 GN=Gpat3 PE=1 SV=1
19	O74765	2.8	30.4	425	0.183	0.066	SYPM_SCHPO Probable proline--tRNA ligase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC24C6.03 PE=3 SV=1
20	Q8K2C8	2.8	30.4	456	0.105	0.035	GPAT4_MOUSE Glycerol-3-phosphate acyltransferase 4 OS=Mus musculus OX=10090 GN=Gpat4 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF10183 ESSS	8.6e-53	188.8	ESSS subunit of NADH:ubiquinone oxidoreductase (complex I)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9598.ENSPTRP00000037483

Rank	PPI partner	STRING score	Description
1	9598.ENSPTRP00000005010	0.999	NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial
2	9598.ENSPTRP00000006209	0.999	Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity)
3	9598.ENSPTRP00000007076	0.999	NADH dehydrogenase [ubiquinone] 1 subunit C2
4	9598.ENSPTRP00000013017	0.999	NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10
5	9598.ENSPTRP00000013471	0.999	Acyl carrier protein, mitochondrial
6	9598.ENSPTRP00000017727	0.999	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7
7	9598.ENSPTRP00000018081	0.999	Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.
8	9598.ENSPTRP00000026930	0.999	NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial
9	9598.ENSPTRP00000035649	0.999	NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6
10	9598.ENSPTRP00000036436	0.999	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8
11	9598.ENSPTRP00000047122	0.999	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5
12	9598.ENSPTRP00000054899	0.999	Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.
13	9598.ENSPTRP00000058761	0.999	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6
14	9598.ENSPTRP00000028892	0.998	Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.
15	9598.ENSPTRP00000035176	0.998	NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9
16	9598.ENSPTRP00000007791	0.997	Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.
17	9598.ENSPTRP00000009015	0.997	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12
18	9598.ENSPTRP00000002642	0.996	NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial
19	9598.ENSPTRP00000026324	0.996	NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4
20	9598.ENSPTRP00000033870	0.996	NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.998	protein binding
GO:0003824	0.366	catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0032981	0.979	mitochondrial respiratory chain complex I assembly

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0070469	0.996	respirasome
GO:0098800	0.996	inner mitochondrial membrane protein complex
GO:0098803	0.994	respiratory chain complex
GO:1990204	0.993	oxidoreductase complex
GO:0005746	0.993	mitochondrial respirasome
GO:0005747	0.964	mitochondrial respiratory chain complex I

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]