StarFunc result for job id Q9NX18

User Input

>input (166 residues)
MAVSTVFSTSSLMLALSRHSLLSPLLSVTSFRRFYRGDSPTDSQKDMIEIPLPPWQERTD
ESIETKRARLLYESRKRGMLENCILLSLFAKEHLQHMTEKQLNLYDRLINEPSNDWDIYY
WATEAKPAPEIFENEVMALLRDFAKNKNKEQRLRAPDLEYLFEKPR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9NX18	1.000	1.000	1.549E-23	166	1.000	1.000	Q9NX18.pdb.gz	SDHF2_HUMAN Succinate dehydrogenase assembly factor 2, mitochondrial OS=Homo sapiens OX=9606 GN=SDHAF2 PE=1 SV=1
2	PDB:6vaxB	0.656	0.953	6.270E-15	113	0.681	1.000	6vaxB.pdb.gz	The roles of SDHAF2 and dicarboxylate in covalent flavinylation of SDHA, the human complex II flavoprotein.
3	AFDB:Q4V5I9	0.641	0.653	2.112E-11	163	0.428	0.436	Q4V5I9.pdb.gz	SDF2A_DROME Succinate dehydrogenase assembly factor 2-A, mitochondrial OS=Drosophila melanogaster OX=7227 GN=CG14757 PE=2 SV=1
4	AFDB:Q08230	0.587	0.601	1.855E-8	162	0.355	0.364	Q08230.pdb.gz	SDHF2_YEAST Succinate dehydrogenase assembly factor 2, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SDH5 PE=1 SV=1
5	AFDB:Q10440	0.604	0.714	9.225E-6	139	0.265	0.317	Q10440.pdb.gz	SDHF2_SCHPO Succinate dehydrogenase assembly factor 2, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=emi5 PE=3 SV=1
6	AFDB:Q584Q5	0.526	0.594	1.953E-4	146	0.211	0.240	Q584Q5.pdb.gz	Q584Q5_TRYB2 Succinate dehydrogenase assembly factor 2, mitochondrial OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb06.4M18.1100 PE=3 SV=1
7	AFDB:F4KBT8	0.464	0.397	2.057E-4	197	0.241	0.203	F4KBT8.pdb.gz	F4KBT8_ARATH Succinate dehydrogenase assembly factor OS=Arabidopsis thaliana OX=3702 GN=SDHAF2 PE=1 SV=1
8	AFDB:A0A178W725	0.161	0.132	3.827E-2	211	0.139	0.109	A0A178W725.pdb.gz	A0A178W725_ARATH CRR41 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g45300 PE=1 SV=1
9	PDB:1x6iA	0.427	0.744	6.772E-2	89	0.120	0.225	1x6iA.pdb.gz
10	AFDB:O82251	0.184	0.154	5.357E-1	208	0.151	0.120	O82251.pdb.gz	TI202_ARATH Protein TIC 20-II, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=TIC20-II PE=2 SV=1
11	AFDB:Q8GZ79	0.152	0.102	8.104E-1	274	0.169	0.102	Q8GZ79.pdb.gz	TI201_ARATH Protein TIC 20-I, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=TIC20-I PE=1 SV=1
12	AFDB:Q9XI73	0.164	0.149	9.464E-1	190	0.120	0.105	Q9XI73.pdb.gz	PNSL2_ARATH Photosynthetic NDH subunit of lumenal location 2, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=PNSL2 PE=1 SV=1
13	PDB:7pfoA	0.224	0.093	9.478E-1	527	0.114	0.036	7pfoA.pdb.gz	Structure of a human replisome shows the organisation and interactions of a DNA replication machine.
14	PDB:7yp9D	0.121	0.026	1.107	1285	0.120	0.016	7yp9D.pdb.gz	Structural basis for intrinsic transcription termination.
15	PDB:2kmfA	0.171	0.216	1.362	115	0.066	0.096	2kmfA.pdb.gz
16	PDB:2g2bA	0.229	0.247	1.590	150	0.078	0.087	2g2bA.pdb.gz
17	PDB:4c5fA	0.223	0.129	2.668	330	0.054	0.027	4c5fA.pdb.gz
18	PDB:7z6hD	0.141	0.090	2.810	324	0.066	0.034	7z6hD.pdb.gz	Structure of the human RAD17-RFC clamp loader and 9-1-1 checkpoint clamp bound to a dsDNA-ssDNA junction.
19	PDB:7rdqD	0.120	0.025	3.456	1366	0.127	0.015	7rdqD.pdb.gz	Structural and mechanistic basis of reiterative transcription initiation.
20	PDB:5n9yA	0.128	0.070	4.036	327	0.060	0.031	5n9yA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9NX18	2.24e-121	340	166	1.000	1.000	SDHF2_HUMAN Succinate dehydrogenase assembly factor 2, mitochondrial OS=Homo sapiens OX=9606 GN=SDHAF2 PE=1 SV=1
2	Q8C6I2	5.28e-106	301	164	0.904	0.915	SDHF2_MOUSE Succinate dehydrogenase assembly factor 2, mitochondrial OS=Mus musculus OX=10090 GN=Sdhaf2 PE=1 SV=1
3	Q4V5I9	1.70e-38	130	163	0.367	0.374	SDF2A_DROME Succinate dehydrogenase assembly factor 2-A, mitochondrial OS=Drosophila melanogaster OX=7227 GN=CG14757 PE=2 SV=1
4	Q08230	3.96e-24	94.0	162	0.355	0.364	SDHF2_YEAST Succinate dehydrogenase assembly factor 2, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SDH5 PE=1 SV=1
5	Q10440	7.44e-14	66.6	139	0.253	0.302	SDHF2_SCHPO Succinate dehydrogenase assembly factor 2, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=emi5 PE=3 SV=1
6	Q584Q5	2.71e-08	52.4	146	0.193	0.219	Q584Q5_TRYB2 Succinate dehydrogenase assembly factor 2, mitochondrial OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb06.4M18.1100 PE=3 SV=1
7	F4KBT8	0.024	36.2	197	0.205	0.173	F4KBT8_ARATH Succinate dehydrogenase assembly factor OS=Arabidopsis thaliana OX=3702 GN=SDHAF2 PE=1 SV=1
8	Q9JKU3	0.20	34.3	1749	0.102	0.010	IF172_RAT Intraflagellar transport protein 172 homolog OS=Rattus norvegicus OX=10116 GN=Ift172 PE=1 SV=1
9	Q6VH22	0.21	34.3	1749	0.102	0.010	IF172_MOUSE Intraflagellar transport protein 172 homolog OS=Mus musculus OX=10090 GN=Ift172 PE=1 SV=1
10	Q9UG01	0.62	32.7	1749	0.096	0.009	IF172_HUMAN Intraflagellar transport protein 172 homolog OS=Homo sapiens OX=9606 GN=IFT172 PE=1 SV=2
11	Q8SZW5	1.8	31.2	543	0.096	0.029	Q8SZW5_DROME Alpha-Esterase-3, isoform A OS=Drosophila melanogaster OX=7227 GN=alpha-Est3 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07954 DUF1689	4.6e+02	12.6	Protein of unknown function (DUF1689)
2	PF00979 Reovirus_cap	7.6e+02	10.6	Reovirus outer capsid protein, Sigma 3
3	PF03937 Sdh5	1.4e-21	87.6	Flavinator of succinate dehydrogenase
4	PF02002 TFIIE_alpha	2.4e+02	13.0	TFIIE alpha subunit

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000301761

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000264932	0.996	Succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial
2	9606.ENSP00000364699	0.936	Succinate dehydrogenase [ubiquinone] cytochrome b small subunit, mitochondrial
3	9606.ENSP00000368165	0.907	Succinate dehydrogenase assembly factor 1, mitochondrial
4	9606.ENSP00000364649	0.882	Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial
5	9606.ENSP00000356953	0.879	Succinate dehydrogenase cytochrome b560 subunit, mitochondrial
6	9606.ENSP00000258439	0.862	Transmembrane protein 127
7	9606.ENSP00000414066	0.793	Succinate dehydrogenase assembly factor 3, mitochondrial
8	9606.ENSP00000359505	0.767	Succinate dehydrogenase assembly factor 4, mitochondrial
9	9606.ENSP00000347942	0.681	Proto-oncogene tyrosine-protein kinase receptor Ret
10	9606.ENSP00000351015	0.668	Neurofibromin
11	9606.ENSP00000339328	0.657	Urokinase plasminogen activator surface receptor
12	9606.ENSP00000365745	0.621	Contributes to the organization of the actin cytoskeleton and cell shape . Plays a role in the formation of lamellipodia and in cell migration. Plays a role in the regulation of neuron morphology, axon growth and formation of neuronal growth cones (By similarity). Through its interaction with CTTNBP2, involved in the regulation of neuronal spine density (By similarity). Plays a role in the invasiveness of cancer cells, and the formation of metastases . Plays a role in focal adhesion assembly and turnover (By similarity). In complex with ABL1 and MYLK regulates cortical actin-based cyto [...]
13	9606.ENSP00000351490	0.615	Protein max
14	9606.ENSP00000196371	0.613	Succinyl-CoA:3-ketoacid coenzyme A transferase 1, mitochondrial
15	9606.ENSP00000263934	0.612	Kinesin-like protein KIF1B
16	9606.ENSP00000355601	0.595	Egl nine homolog 1
17	9606.ENSP00000363064	0.589	Zinc finger protein 76
18	9606.ENSP00000344782	0.585	Zinc finger protein Gfi-1b
19	9606.ENSP00000355518	0.580	Fumarate hydratase, mitochondrial
20	9606.ENSP00000479618	0.580	Myc proto-oncogene protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003824	0.412	catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044237	0.995	cellular metabolic process
GO:0071704	0.990	organic substance metabolic process
GO:0050794	0.987	regulation of cellular process
GO:0044238	0.981	primary metabolic process
GO:0009966	0.979	regulation of signal transduction
GO:1901564	0.969	organonitrogen compound metabolic process
GO:0030111	0.966	regulation of Wnt signaling pathway
GO:0043170	0.965	macromolecule metabolic process
GO:0016311	0.955	dephosphorylation
GO:0036211	0.939	protein modification process
GO:0048519	0.936	negative regulation of biological process
GO:0048523	0.826	negative regulation of cellular process
GO:0006091	0.677	generation of precursor metabolites and energy
GO:0015980	0.633	energy derivation by oxidation of organic compounds
GO:0048585	0.632	negative regulation of response to stimulus
GO:0009968	0.522	negative regulation of signal transduction
GO:0045595	0.498	regulation of cell differentiation
GO:0051239	0.479	regulation of multicellular organismal process
GO:0045333	0.459	cellular respiration
GO:0051093	0.421	negative regulation of developmental process
GO:0051241	0.420	negative regulation of multicellular organismal process
GO:0060828	0.415	regulation of canonical Wnt signaling pathway
GO:0045596	0.394	negative regulation of cell differentiation
GO:0030178	0.370	negative regulation of Wnt signaling pathway
GO:0006470	0.363	protein dephosphorylation
GO:0090090	0.363	negative regulation of canonical Wnt signaling pathway
GO:0010717	0.361	regulation of epithelial to mesenchymal transition
GO:0009060	0.359	aerobic respiration
GO:0010719	0.300	negative regulation of epithelial to mesenchymal transition

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	0.999	mitochondrion
GO:0031981	0.997	nuclear lumen
GO:0043232	0.990	intracellular non-membrane-bounded organelle
GO:0005829	0.979	cytosol
GO:0032991	0.571	protein-containing complex
GO:0005730	0.526	nucleolus
GO:0016020	0.518	membrane
GO:0005654	0.421	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]