StarFunc result for job id Q9NX38

User Input

>input (181 residues)
MATEPEAAEPVVPSLVDRYFTRWYKPDVKGKFCEDHCILQHSNRICVITLAESHPVLQSG
KTIKSISYQISTNCSRLQNKVSGKFKRGAQFLTELAPLCKIYCSDGEEYTVSSCVRGRLM
EVNENILHKPSILQEKPSTEGYIAVVLPKFEESKSITEGLLTQKQYEEVMVKRINATTAT
S

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9NX38	1.000	1.000	9.639E-38	181	1.000	1.000	Q9NX38.pdb.gz	ABITM_HUMAN Protein Abitram OS=Homo sapiens OX=9606 GN=ABITRAM PE=1 SV=1
2	AFDB:Q80ZQ9	0.940	0.881	6.408E-32	193	0.851	0.798	Q80ZQ9.pdb.gz	ABITM_MOUSE Protein Abitram OS=Mus musculus OX=10090 GN=Abitram PE=1 SV=2
3	AFDB:Q581S9	0.726	0.670	2.820E-15	197	0.254	0.234	Q581S9.pdb.gz	Q581S9_TRYB2 Protein Abitram OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb04.2L9.790 PE=4 SV=1
4	AFDB:P23434	0.610	0.636	1.123E-7	173	0.116	0.121	P23434.pdb.gz	GCSH_HUMAN Glycine cleavage system H protein, mitochondrial OS=Homo sapiens OX=9606 GN=GCSH PE=1 SV=2
5	AFDB:Q5I0P2	0.618	0.655	2.033E-7	170	0.110	0.118	Q5I0P2.pdb.gz	GCSH_RAT Glycine cleavage system H protein, mitochondrial OS=Rattus norvegicus OX=10116 GN=Gcsh PE=2 SV=1
6	AFDB:P20821	0.623	0.650	3.080E-7	173	0.099	0.104	P20821.pdb.gz	GCSH_BOVIN Glycine cleavage system H protein, mitochondrial OS=Bos taurus OX=9913 GN=GCSH PE=1 SV=1
7	AFDB:P16048	0.577	0.629	3.905E-7	165	0.138	0.152	P16048.pdb.gz	GCSH_PEA Glycine cleavage system H protein, mitochondrial OS=Pisum sativum OX=3888 GN=GDCSH PE=1 SV=1
8	AFDB:Q9LQL0	0.593	0.643	6.660E-7	166	0.133	0.145	Q9LQL0.pdb.gz	GCSH3_ARATH Glycine cleavage system H protein 3, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=GDH3 PE=1 SV=1
9	AFDB:P11183	0.626	0.687	1.009E-6	164	0.099	0.110	P11183.pdb.gz	GCSH_CHICK Glycine cleavage system H protein, mitochondrial OS=Gallus gallus OX=9031 GN=GCSH PE=1 SV=2
10	AFDB:Q9HDV9	0.624	0.666	1.205E-6	169	0.105	0.112	Q9HDV9.pdb.gz	GCSH_SCHPO Putative glycine cleavage system H protein, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gcv3 PE=1 SV=1
11	PDB:3a7lA	0.580	0.798	2.033E-6	128	0.105	0.148	3a7lA.pdb.gz
12	PDB:5nnzA	0.126	0.077	4.646E-1	335	0.077	0.042	5nnzA.pdb.gz
13	PDB:4znoA	0.181	0.117	5.551E-1	318	0.077	0.044	4znoA.pdb.gz	Structural basis for receptor recognition and pore formation of a zebrafish aerolysin-like protein.
14	PDB:3n6rA	0.180	0.056	6.251E-1	591	0.044	0.014	3n6rA.pdb.gz	Crystal structure of the alpha(6)beta(6) holoenzyme of propionyl-coenzyme A carboxylase.
15	PDB:5lcwA	0.135	0.027	6.633E-1	1441	0.077	0.010	5lcwA.pdb.gz	Molecular basis of APC/C regulation by the spindle assembly checkpoint.
16	PDB:7ktrB	0.178	0.079	7.038E-1	534	0.066	0.022	7ktrB.pdb.gz	Structure of the human SAGA coactivator complex.
17	PDB:7c8zA	0.122	0.072	7.925E-1	383	0.110	0.052	7c8zA.pdb.gz	Structural and Biochemical Analysis Reveals a Distinct Catalytic Site of Salicylate 5-Monooxygenase NagGH from Rieske Dioxygenases.
18	PDB:3n6rG	0.179	0.052	8.409E-1	646	0.044	0.012	3n6rG.pdb.gz	Crystal structure of the alpha(6)beta(6) holoenzyme of propionyl-coenzyme A carboxylase.
19	PDB:3bg5B	0.194	0.037	8.923E-1	1074	0.077	0.013	3bg5B.pdb.gz	Crystal structures of human and Staphylococcus aureus pyruvate carboxylase and molecular insights into the carboxyltransfer reaction.
20	PDB:7trcK	0.130	0.080	9.469E-1	330	0.105	0.058	7trcK.pdb.gz	Structure of active human telomerase with telomere shelterin protein TPP1.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9NX38	7.15e-135	376	181	1.000	1.000	ABITM_HUMAN Protein Abitram OS=Homo sapiens OX=9606 GN=ABITRAM PE=1 SV=1
2	Q80ZQ9	6.85e-113	321	193	0.845	0.793	ABITM_MOUSE Protein Abitram OS=Mus musculus OX=10090 GN=Abitram PE=1 SV=2
3	Q581S9	7.75e-17	76.6	197	0.287	0.264	Q581S9_TRYB2 Protein Abitram OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb04.2L9.790 PE=4 SV=1
4	O32174	0.016	36.2	127	0.105	0.150	GCSH_BACSU Glycine cleavage system H protein OS=Bacillus subtilis (strain 168) OX=224308 GN=gcvH PE=1 SV=1
5	P39726	0.11	34.3	170	0.099	0.106	GCSH_YEAST Glycine cleavage system H protein, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GCV3 PE=1 SV=3
6	P16048	0.33	33.1	165	0.094	0.103	GCSH_PEA Glycine cleavage system H protein, mitochondrial OS=Pisum sativum OX=3888 GN=GDCSH PE=1 SV=1
7	Q8VXV7	0.72	32.7	844	0.088	0.019	LDL1_ARATH Lysine-specific histone demethylase 1 homolog 1 OS=Arabidopsis thaliana OX=3702 GN=LDL1 PE=1 SV=1
8	O82179	2.2	30.4	156	0.061	0.071	GCSH2_ARATH Glycine cleavage system H protein 2, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=GDH2 PE=2 SV=1
9	Q9P5N0	3.8	30.4	1465	0.127	0.016	ABC3_SCHPO Vacuolar heme ABC transmembrane exporter abc3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=abc3 PE=1 SV=1
10	P20851	4.8	30.0	252	0.249	0.179	C4BPB_HUMAN C4b-binding protein beta chain OS=Homo sapiens OX=9606 GN=C4BPB PE=1 SV=1
11	D3Z822	4.9	30.4	2636	0.094	0.006	D3Z822_RAT Serine/threonine-protein kinase ATR OS=Rattus norvegicus OX=10116 GN=Atr PE=3 SV=3
12	A0A8I6G5M3	5.0	30.4	2570	0.094	0.007	A0A8I6G5M3_RAT Serine/threonine-protein kinase ATR OS=Rattus norvegicus OX=10116 GN=Atr PE=3 SV=1
13	Q90XE6	5.7	29.6	365	0.099	0.049	KLF1_DANRE Kruppel-like factor 1 OS=Danio rerio OX=7955 GN=klf1 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01597 GCV_H	0.0052	28.1	Glycine cleavage H-protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000363753

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000326003	0.921	Putative tRNA pseudouridine synthase Pus10
2	9606.ENSP00000477141	0.913	DOMON domain-containing protein FRRS1L
3	9606.ENSP00000320434	0.655	Alpha-catulin
4	9606.ENSP00000287387	0.642	Protein N-terminal glutamine amidohydrolase
5	9606.ENSP00000394049	0.639	Src-like-adapter
6	9606.ENSP00000300145	0.633	Mitochondrial inner membrane protease ATP23 homolog
7	9606.ENSP00000223321	0.631	Proteasome subunit alpha type-2
8	9606.ENSP00000414851	0.628	Elongator complex protein 2
9	9606.ENSP00000430823	0.615	Zinc finger protein 706
10	9606.ENSP00000276569	0.613	Armadillo repeat containing 1
11	9606.ENSP00000483312	0.605	WD repeat-containing protein 38
12	9606.ENSP00000354458	0.602	Complement component C8 alpha chain
13	9606.ENSP00000435460	0.602	Galectin 8
14	9606.ENSP00000360281	0.560	Complement component C8 beta chain
15	9606.ENSP00000319531	0.556	Glycine cleavage system H protein, mitochondrial
16	9606.ENSP00000363714	0.556	Belongs to the autoinducer-2 exporter (AI-2E) (TC 2.A.86) family
17	9606.ENSP00000481185	0.513	Grifin
18	9606.ENSP00000238875	0.511	Galectin-related protein
19	9606.ENSP00000322270	0.511	Adhesion G protein-coupled receptor L2
20	9606.ENSP00000374049	0.505	Von Willebrand factor A domain containing 3A

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0003785	0.667	actin monomer binding
GO:0051015	0.622	actin filament binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.997	cellular process
GO:0050789	0.989	regulation of biological process
GO:0050794	0.979	regulation of cellular process
GO:0051128	0.954	regulation of cellular component organization
GO:0016043	0.925	cellular component organization
GO:0044087	0.908	regulation of cellular component biogenesis
GO:0032970	0.856	regulation of actin filament-based process
GO:0090066	0.501	regulation of anatomical structure size
GO:0033043	0.487	regulation of organelle organization
GO:0032535	0.483	regulation of cellular component size
GO:0032502	0.448	developmental process
GO:0048856	0.440	anatomical structure development
GO:0032501	0.428	multicellular organismal process
GO:0007275	0.403	multicellular organism development
GO:0120035	0.370	regulation of plasma membrane bounded cell projection organization
GO:1902903	0.367	regulation of supramolecular fiber organization
GO:0043254	0.367	regulation of protein-containing complex assembly
GO:0032956	0.366	regulation of actin cytoskeleton organization
GO:0000902	0.362	cell morphogenesis
GO:0110053	0.362	regulation of actin filament organization
GO:0031175	0.362	neuron projection development
GO:0060491	0.355	regulation of cell projection assembly
GO:0048667	0.349	cell morphogenesis involved in neuron differentiation
GO:0048812	0.349	neuron projection morphogenesis
GO:0032271	0.335	regulation of protein polymerization
GO:0120032	0.328	regulation of plasma membrane bounded cell projection assembly
GO:0016358	0.328	dendrite development
GO:0030833	0.327	regulation of actin filament polymerization
GO:0048813	0.311	dendrite morphogenesis
GO:0050896	0.309	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.996	nucleoplasm
GO:0120025	0.979	plasma membrane bounded cell projection
GO:0005737	0.926	cytoplasm
GO:0043005	0.889	neuron projection
GO:0036477	0.885	somatodendritic compartment
GO:0030424	0.884	axon
GO:0030425	0.882	dendrite
GO:0030427	0.872	site of polarized growth
GO:0150034	0.862	distal axon
GO:0016607	0.862	nuclear speck
GO:0031252	0.855	cell leading edge
GO:0030426	0.845	growth cone
GO:0032433	0.842	filopodium tip
GO:0030027	0.838	lamellipodium
GO:0032991	0.829	protein-containing complex
GO:0005829	0.465	cytosol
GO:1902494	0.364	catalytic complex
GO:0065010	0.357	extracellular membrane-bounded organelle
GO:0043228	0.345	non-membrane-bounded organelle
GO:0043232	0.325	intracellular non-membrane-bounded organelle
GO:0031982	0.323	vesicle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]