StarFunc result for job id Q9NX45

User Input

>input (425 residues)
MASSIICQEHCQISGQAKIDILLVGDVTVGYLADTVQKLFANIAEVTITISDTKEAAALL
DDCIFNMVLLKVPSSLSAEELEAIKLIRFGKKKNTHSLFVFIIPENFKGCISGHGMDIAL
TEPLTMEKMSNVVKYWTTCPSNTVKTENATGPEELGLPLQRSYSEHLGYFPTDLFACSES
LRNGNGLELNASLSEFEKNKKISLLHSSKEKLRRERIKYCCEQLRTLLPYVKGRKNDAAS
VLEATVDYVKYIREKISPAVMAQITEALQSNMRFCKKQQTPIELSLPGTVMAQRENSVMS
TYSPERGLQFLTNTCWNGCSTPDAESSLDEAVRVPSSSASENAIGDPYKTHISSAALSLN
SLHTVRYYSKVTPSYDATAVTNQNISIHLPSAMPPVSKLLPRHCTSGLGQTCTTHPNCLQ
QFWAY

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9NX45	1.000	1.000	7.979E-77	425	1.000	1.000	Q9NX45.pdb.gz	SOLH2_HUMAN Spermatogenesis- and oogenesis-specific basic helix-loop-helix-containing protein 2 OS=Homo sapiens OX=9606 GN=SOHLH2 PE=2 SV=2
2	AFDB:Q9D489	0.312	0.286	4.851E-40	467	0.513	0.467	Q9D489.pdb.gz	SOLH2_MOUSE Spermatogenesis- and oogenesis-specific basic helix-loop-helix-containing protein 2 OS=Mus musculus OX=10090 GN=Sohlh2 PE=1 SV=2
3	AFDB:Q5SML5	0.212	0.138	6.689E-8	696	0.139	0.085	Q5SML5.pdb.gz	ORR22_ORYSJ Two-component response regulator ORR22 OS=Oryza sativa subsp. japonica OX=39947 GN=RR22 PE=2 SV=1
4	AFDB:O49397	0.228	0.186	2.179E-7	552	0.144	0.111	O49397.pdb.gz	ARR10_ARATH Two-component response regulator ARR10 OS=Arabidopsis thaliana OX=3702 GN=ARR10 PE=1 SV=1
5	AFDB:Q9CAA4	0.154	0.201	3.405E-5	311	0.122	0.167	Q9CAA4.pdb.gz	BIM2_ARATH Transcription factor BIM2 OS=Arabidopsis thaliana OX=3702 GN=BIM2 PE=1 SV=1
6	PDB:2gwrA	0.232	0.414	3.878E-5	225	0.042	0.080	2gwrA.pdb.gz	Domain orientation in the inactive response regulator Mycobacterium tuberculosis MtrA provides a barrier to activation.
7	PDB:3a10A	0.228	0.710	9.716E-5	116	0.049	0.181	3a10A.pdb.gz	Structure of PAS-linked histidine kinase and the response regulator complex
8	PDB:6z4cA	0.226	0.626	1.538E-4	127	0.049	0.165	6z4cA.pdb.gz
9	AFDB:Q6IUP1	0.118	0.138	1.875E-4	357	0.167	0.199	Q6IUP1.pdb.gz	SOLH1_MOUSE Spermatogenesis- and oogenesis-specific basic helix-loop-helix-containing protein 1 OS=Mus musculus OX=10090 GN=Sohlh1 PE=1 SV=1
10	PDB:6c40D	0.213	0.673	3.165E-4	118	0.042	0.153	6c40D.pdb.gz	Site-Specific Incorporation of a Cu2+Spin Label into Proteins for Measuring Distances by Pulsed Dipolar Electron Spin Resonance Spectroscopy.
11	PDB:6rgzD	0.223	0.684	3.609E-4	122	0.045	0.156	6rgzD.pdb.gz	Revisiting the pH-gated conformational switch on the activities of HisKA-family histidine kinases.
12	PDB:4l4uA	0.219	0.238	3.853E-4	388	0.064	0.070	4l4uA.pdb.gz
13	PDB:4knyB	0.240	0.424	4.114E-4	226	0.045	0.084	4knyB.pdb.gz	An asymmetric heterodomain interface stabilizes a response regulator-DNA complex.
14	PDB:3kyjB	0.214	0.594	6.513E-4	129	0.045	0.147	3kyjB.pdb.gz
15	PDB:4ldzA	0.222	0.439	7.929E-4	196	0.042	0.092	4ldzA.pdb.gz	Allosteric activation of bacterial response regulators: the role of the cognate histidine kinase beyond phosphorylation.
16	PDB:3breB	0.225	0.286	8.467E-4	328	0.042	0.055	3breB.pdb.gz	Phosphorylation-independent regulation of the diguanylate cyclase WspR.
17	AFDB:Q9DBX7	0.141	0.176	8.478E-4	326	0.115	0.150	Q9DBX7.pdb.gz	HEYL_MOUSE Hairy/enhancer-of-split related with YRPW motif-like protein OS=Mus musculus OX=10090 GN=Heyl PE=1 SV=2
18	AFDB:Q8W2F2	0.136	0.195	1.032E-3	286	0.111	0.164	Q8W2F2.pdb.gz	BH011_ARATH Transcription factor bHLH11 OS=Arabidopsis thaliana OX=3702 GN=BHLH11 PE=2 SV=2
19	AFDB:Q948F6	0.133	0.184	1.177E-3	298	0.125	0.178	Q948F6.pdb.gz	Q948F6_ORYSA Putative SPATULA OS=Oryza sativa OX=4530 GN=OSJNBa0049O12.18 PE=3 SV=1
20	AFDB:A0A2R8RRI1	0.150	0.132	1.989E-3	493	0.108	0.093	A0A2R8RRI1.pdb.gz	A0A2R8RRI1_DANRE Transcription factor EB OS=Danio rerio OX=7955 GN=tfeb PE=3 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9NX45	0.0	885	425	1.000	1.000	SOLH2_HUMAN Spermatogenesis- and oogenesis-specific basic helix-loop-helix-containing protein 2 OS=Homo sapiens OX=9606 GN=SOHLH2 PE=2 SV=2
2	Q9D489	1.19e-140	412	467	0.513	0.467	SOLH2_MOUSE Spermatogenesis- and oogenesis-specific basic helix-loop-helix-containing protein 2 OS=Mus musculus OX=10090 GN=Sohlh2 PE=1 SV=2
3	Q5JUK2	9.05e-06	49.7	328	0.047	0.061	SOLH1_HUMAN Spermatogenesis- and oogenesis-specific basic helix-loop-helix-containing protein 1 OS=Homo sapiens OX=9606 GN=SOHLH1 PE=1 SV=4
4	Q9ZUG9	1.64e-05	48.9	350	0.064	0.077	LRL1_ARATH Transcription factor LRL1 OS=Arabidopsis thaliana OX=3702 GN=LRL1 PE=1 SV=1
5	Q8S3D5	2.32e-05	48.5	310	0.056	0.077	LRL2_ARATH Transcription factor LRL2 OS=Arabidopsis thaliana OX=3702 GN=LRL2 PE=2 SV=2
6	Q7Y1H4	4.69e-04	44.3	294	0.054	0.078	Q7Y1H4_ORYSJ Lipoamide dehydrogenase, putative, expressed OS=Oryza sativa subsp. japonica OX=39947 GN=LOC_Os03g58330 PE=2 SV=1
7	Q9CAA4	4.93e-04	44.3	311	0.068	0.093	BIM2_ARATH Transcription factor BIM2 OS=Arabidopsis thaliana OX=3702 GN=BIM2 PE=1 SV=1
8	Q6Z339	8.86e-04	43.5	344	0.047	0.058	Q6Z339_ORYSJ Os02g0726700 protein OS=Oryza sativa subsp. japonica OX=39947 GN=Os02g0726700 PE=3 SV=1
9	Q69Y51	0.001	43.5	401	0.049	0.052	Q69Y51_ORYSJ BHLH transcription factor PTF1 OS=Oryza sativa subsp. japonica OX=39947 GN=P0698A06.26-2 PE=3 SV=1
10	Q9LSQ3	0.001	42.7	297	0.049	0.071	LRL3_ARATH Transcription factor LRL3 OS=Arabidopsis thaliana OX=3702 GN=LRL3 PE=2 SV=1
11	Q6EPZ6	0.002	43.1	499	0.049	0.042	Q6EPZ6_ORYSJ BHLH transcription factor PTF1-like protein OS=Oryza sativa subsp. japonica OX=39947 GN=Os09g0417400 PE=3 SV=1
12	P28574	0.005	39.7	160	0.040	0.106	MAX_MOUSE Protein max OS=Mus musculus OX=10090 GN=Max PE=1 SV=2
13	P52164	0.005	39.7	160	0.040	0.106	MAX_RAT Protein max OS=Rattus norvegicus OX=10116 GN=Max PE=1 SV=1
14	Q69JI7	0.005	41.6	504	0.052	0.044	Q69JI7_ORYSJ BHLH transcription factor OS=Oryza sativa subsp. japonica OX=39947 GN=Os09g0475400 PE=1 SV=1
15	Q6Z7E7	0.005	41.6	524	0.049	0.040	Q6Z7E7_ORYSJ Os02g0564700 protein OS=Oryza sativa subsp. japonica OX=39947 GN=Os02g0564700 PE=2 SV=1
16	Q6ZBQ2	0.005	41.2	508	0.045	0.037	Q6ZBQ2_ORYSJ BHLH transcription factor OS=Oryza sativa subsp. japonica OX=39947 GN=Os08g0490000 PE=1 SV=1
17	P61244	0.006	39.7	160	0.040	0.106	MAX_HUMAN Protein max OS=Homo sapiens OX=9606 GN=MAX PE=1 SV=1
18	A0A2R6QE26	0.007	41.2	689	0.061	0.038	BHL42_ACTCC Transcription factor BHLH42 OS=Actinidia chinensis var. chinensis OX=1590841 GN=BHLH42 PE=1 SV=1
19	Q07016	0.007	39.3	163	0.040	0.104	MAX_XENLA Protein max OS=Xenopus laevis OX=8355 GN=max PE=2 SV=1
20	Q5VRS4	0.009	40.4	315	0.061	0.083	Q5VRS4_ORYSJ Basic helix-loop-helix protein SPATULA-like OS=Oryza sativa subsp. japonica OX=39947 GN=OsJ_20240 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13477 Glyco_trans_4_2	26	16.4	Glycosyl transferase 4-like
2	PF00010 HLH	7.4e-06	37.2	Helix-loop-helix DNA-binding domain
3	PF04662 Luteo_PO	43	15.2	Luteovirus P0 protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000369210

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000404438	0.965	Spermatogenesis- and oogenesis-specific basic helix-loop-helix-containing protein 1
2	9606.ENSP00000309572	0.790	Telomerase reverse transcriptase
3	9606.ENSP00000419457	0.741	Homeobox protein NOBOX
4	9606.ENSP00000333097	0.717	Factor in the germline alpha
5	9606.ENSP00000294638	0.711	LIM/homeobox protein Lhx8
6	9606.ENSP00000275764	0.707	Stimulated by retinoic acid gene 8 protein homolog
7	9606.ENSP00000341021	0.686	Nanos homolog 2
8	9606.ENSP00000245255	0.662	Piwi-like protein 1
9	9606.ENSP00000250863	0.645	Deleted in azoospermia-like
10	9606.ENSP00000371711	0.637	Doublesex- and mab-3-related transcription factor 1
11	9606.ENSP00000347591	0.610	GDNF family receptor alpha-1
12	9606.ENSP00000338157	0.598	Zinc finger and BTB domain-containing protein 16
13	9606.ENSP00000341992	0.578	Nanos homolog 3
14	9606.ENSP00000358535	0.565	Synaptonemal complex protein 1
15	9606.ENSP00000426174	0.555	Coiled-coil domain containing 169
16	9606.ENSP00000376658	0.548	Synaptonemal complex protein 3
17	9606.ENSP00000367942	0.538	Growth/differentiation factor 9
18	9606.ENSP00000293805	0.537	B-cell CLL/lymphoma 6 member B protein
19	9606.ENSP00000359567	0.536	Transcription factor SOX-3
20	9606.ENSP00000305995	0.535	Phosphoglycerate kinase 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:1990837	1.000	sequence-specific double-stranded DNA binding
GO:0005515	0.971	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.997	regulation of cellular process
GO:0009987	0.983	cellular process
GO:0051173	0.976	positive regulation of nitrogen compound metabolic process
GO:0010604	0.975	positive regulation of macromolecule metabolic process
GO:0031325	0.975	positive regulation of cellular metabolic process
GO:0031326	0.972	regulation of cellular biosynthetic process
GO:0032501	0.970	multicellular organismal process
GO:0010556	0.970	regulation of macromolecule biosynthetic process
GO:0019219	0.966	regulation of nucleobase-containing compound metabolic process
GO:0000003	0.962	reproduction
GO:0010468	0.960	regulation of gene expression
GO:0051252	0.932	regulation of RNA metabolic process
GO:0051254	0.923	positive regulation of RNA metabolic process
GO:0006355	0.885	regulation of DNA-templated transcription
GO:0032502	0.879	developmental process
GO:0010557	0.815	positive regulation of macromolecule biosynthetic process
GO:0006357	0.814	regulation of transcription by RNA polymerase II
GO:0031328	0.810	positive regulation of cellular biosynthetic process
GO:0022414	0.808	reproductive process
GO:0048856	0.773	anatomical structure development
GO:1902680	0.758	positive regulation of RNA biosynthetic process
GO:0045893	0.627	positive regulation of DNA-templated transcription
GO:0007275	0.541	multicellular organism development
GO:0019953	0.529	sexual reproduction
GO:0048609	0.517	multicellular organismal reproductive process
GO:0007276	0.500	gamete generation
GO:0030154	0.405	cell differentiation
GO:0008152	0.339	metabolic process
GO:0048731	0.338	system development
GO:0003006	0.316	developmental process involved in reproduction
GO:0045944	0.313	positive regulation of transcription by RNA polymerase II
GO:0071704	0.303	organic substance metabolic process
GO:0044237	0.300	cellular metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043229	0.995	intracellular organelle
GO:0005634	0.994	nucleus
GO:0005737	0.944	cytoplasm
GO:0032991	0.698	protein-containing complex
GO:0031981	0.637	nuclear lumen
GO:0005654	0.465	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]