StarFunc result for job id Q9NX46

User Input

>input (363 residues)
MAAAAMAAAAGGGAGAARSLSRFRGCLAGALLGDCVGSFYEAHDTVDLTSVLRHVQSLEP
DPGTPGSERTEALYYTDDTAMARALVQSLLAKEAFDEVDMAHRFAQEYKKDPDRGYGAGV
VTVFKKLLNPKCRDVFEPARAQFNGKGSYGNGGAMRVAGISLAYSSVQDVQKFARLSAQL
THASSLGYNGAILQALAVHLALQGESSSEHFLKQLLGHMEDLEGDAQSVLDARELGMEER
PYSSRLKKIGELLDQASVTREEVVSELGNGIAAFESVPTAIYCFLRCMEPDPEIPSAFNS
LQRTLIYSISLGGDTDTIATMAGAIAGAYYGMDQVPESWQQSCEGYEETDILAQSLHRVF
QKS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8CG72	0.977	0.958	1.551E-50	370	0.912	0.895	Q8CG72.pdb.gz	ADPRS_MOUSE ADP-ribosylhydrolase ARH3 OS=Mus musculus OX=10090 GN=Adprs PE=1 SV=1
2	PDB:6d3aA	0.922	0.964	5.197E-46	347	0.950	0.994	6d3aA.pdb.gz	Structure of human ADP-ribosyl-acceptor hydrolase 3 bound to ADP-ribose reveals a conformational switch that enables specific substrate recognition.
3	AFDB:H3BCW1	0.906	0.924	1.165E-35	356	0.617	0.629	H3BCW1.pdb.gz	ADPRS_LATCH ADP-ribosylhydrolase ARH3 OS=Latimeria chalumnae OX=7897 GN=adprs PE=1 SV=1
4	PDB:6g1qB	0.879	0.963	3.198E-34	331	0.598	0.656	6g1qB.pdb.gz	(ADP-ribosyl)hydrolases: Structural Basis for Differential Substrate Recognition and Inhibition.
5	PDB:2wocA	0.646	0.794	2.005E-10	291	0.190	0.237	2wocA.pdb.gz	Mechanism of Adp-Ribosylation Removal Revealed by the Structure and Ligand Complexes of the Dimanganese Mono-Adp-Ribosylhydrolase Drag.
6	AFDB:P14300	0.633	0.771	2.382E-10	294	0.187	0.231	P14300.pdb.gz	DRAG_RHORU ADP-ribosyl-[dinitrogen reductase] glycohydrolase OS=Rhodospirillum rubrum OX=1085 GN=draG PE=1 SV=1
7	PDB:6g2aA	0.701	0.705	1.730E-9	361	0.185	0.186	6g2aA.pdb.gz	(ADP-ribosyl)hydrolases: Structural Basis for Differential Substrate Recognition and Inhibition.
8	AFDB:P54922	0.703	0.714	2.834E-9	357	0.193	0.196	P54922.pdb.gz	ADPRH_HUMAN ADP-ribosylhydrolase ARH1 OS=Homo sapiens OX=9606 GN=ADPRH PE=1 SV=1
9	AFDB:P54923	0.672	0.674	2.834E-9	362	0.193	0.193	P54923.pdb.gz	ADPRH_MOUSE ADP-ribosylhydrolase ARH1 OS=Mus musculus OX=10090 GN=Adprh PE=1 SV=1
10	AFDB:Q6AZR2	0.700	0.716	6.469E-9	354	0.174	0.178	Q6AZR2.pdb.gz	ARHL1_XENLA Inactive ADP-ribosyltransferase arh2 OS=Xenopus laevis OX=8355 GN=adprhl1 PE=1 SV=1
11	AFDB:Q382Z4	0.525	0.544	1.486E-4	349	0.143	0.149	Q382Z4.pdb.gz	Q382Z4_TRYB2 ADP-ribosylglycohydrolase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.3710 PE=4 SV=1
12	PDB:4f4cA	0.091	0.038	5.827E-2	1250	0.121	0.035	4f4cA.pdb.gz	Crystal structure of the multidrug transporter P-glycoprotein from Caenorhabditis elegans.
13	AFDB:P21345	0.146	0.130	9.119E-2	437	0.132	0.110	P21345.pdb.gz	GLTP_ECOLI Proton/glutamate-aspartate symporter OS=Escherichia coli (strain K12) OX=83333 GN=gltP PE=1 SV=2
14	PDB:6s4mA	0.138	0.124	1.010E-1	426	0.113	0.096	6s4mA.pdb.gz
15	AFDB:P67444	0.120	0.101	1.316E-1	466	0.121	0.094	P67444.pdb.gz	XANQ_ECOLI Xanthine permease XanQ OS=Escherichia coli (strain K12) OX=83333 GN=xanQ PE=1 SV=2
16	AFDB:Q91WN3	0.119	0.099	1.442E-1	478	0.083	0.063	Q91WN3.pdb.gz	S7A13_MOUSE Solute carrier family 7 member 13 OS=Mus musculus OX=10090 GN=Slc7a13 PE=1 SV=1
17	PDB:7qp9A	0.129	0.137	2.104E-1	327	0.116	0.128	7qp9A.pdb.gz	Structures and mechanism of the plant PIN-FORMED auxin transporter.
18	PDB:5kucA	0.120	0.107	2.528E-1	402	0.080	0.072	5kucA.pdb.gz
19	PDB:7p5cA	0.100	0.094	3.179E-1	392	0.121	0.112	7p5cA.pdb.gz
20	PDB:1w07B	0.147	0.094	4.803E-1	658	0.129	0.071	1w07B.pdb.gz	Acyl-Coa Oxidase 1 from Arabidopsis Thaliana. Structure of a Key Enzyme in Plant Lipid Metabolism

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	G3H9W3	0.0	557	284	0.730	0.933	G3H9W3_CRIGR Poly(ADP-ribose) glycohydrolase ARH3 OS=Cricetulus griseus OX=10029 GN=I79_007194 PE=3 SV=1
2	Q8CG72	0.0	671	370	0.882	0.865	ADPRS_MOUSE ADP-ribosylhydrolase ARH3 OS=Mus musculus OX=10090 GN=Adprs PE=1 SV=1
3	Q9NX46	0.0	744	363	1.000	1.000	ADPRS_HUMAN ADP-ribosylhydrolase ARH3 OS=Homo sapiens OX=9606 GN=ADPRS PE=1 SV=1
4	H3BCW1	4.85e-154	439	356	0.617	0.629	ADPRS_LATCH ADP-ribosylhydrolase ARH3 OS=Latimeria chalumnae OX=7897 GN=adprs PE=1 SV=1
5	P14300	9.02e-08	55.5	294	0.190	0.235	DRAG_RHORU ADP-ribosyl-[dinitrogen reductase] glycohydrolase OS=Rhodospirillum rubrum OX=1085 GN=draG PE=1 SV=1
6	P54923	0.12	36.6	362	0.190	0.191	ADPRH_MOUSE ADP-ribosylhydrolase ARH1 OS=Mus musculus OX=10090 GN=Adprh PE=1 SV=1
7	Q02589	0.19	35.8	362	0.190	0.191	ADPRH_RAT ADP-ribosylhydrolase ARH1 OS=Rattus norvegicus OX=10116 GN=Adprh PE=1 SV=2
8	Q84K72	0.41	34.7	277	0.069	0.090	Q84K72_ARATH Forkhead-associated domain protein OS=Arabidopsis thaliana OX=3702 GN=At1g06510 PE=1 SV=1
9	Q8R2G6	2.7	32.7	949	0.050	0.019	CCD80_MOUSE Coiled-coil domain-containing protein 80 OS=Mus musculus OX=10090 GN=Ccdc80 PE=1 SV=2
10	F4IIZ3	9.1	30.8	793	0.058	0.026	F4IIZ3_ARATH Potassium transporter OS=Arabidopsis thaliana OX=3702 GN=KUP11 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03747 ADP_ribosyl_GH	2.3e-58	209.8	ADP-ribosylglycohydrolase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000362273

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000384408	0.944	Poly(ADP-ribose) glycohydrolase
2	9606.ENSP00000217246	0.916	O-acetyl-ADP-ribose deacetylase MACROD2
3	9606.ENSP00000255681	0.862	O-acetyl-ADP-ribose deacetylase MACROD1
4	9606.ENSP00000420484	0.783	O-acetyl-ADP-ribose deacetylase 1
5	9606.ENSP00000381740	0.693	Poly [ADP-ribose] polymerase 3
6	9606.ENSP00000420200	0.690	[Protein ADP-ribosylarginine] hydrolase
7	9606.ENSP00000355759	0.689	Poly [ADP-ribose] polymerase 1
8	9606.ENSP00000311579	0.687	Tankyrase-1
9	9606.ENSP00000356416	0.686	60 kDa SS-A/Ro ribonucleoprotein
10	9606.ENSP00000479494	0.679	PCI domain containing 2
11	9606.ENSP00000250416	0.668	Poly [ADP-ribose] polymerase 2
12	9606.ENSP00000406598	0.654	Histone PARylation factor 1
13	9606.ENSP00000422375	0.653	U8 snoRNA-decapping enzyme
14	9606.ENSP00000417214	0.634	Poly [ADP-ribose] polymerase 15
15	9606.ENSP00000418194	0.630	Poly [ADP-ribose] polymerase 14
16	9606.ENSP00000325618	0.603	Poly [ADP-ribose] polymerase 10
17	9606.ENSP00000326170	0.602	E3 ubiquitin-protein ligase rififylin
18	9606.ENSP00000261888	0.583	Mono [ADP-ribose] polymerase PARP16
19	9606.ENSP00000360689	0.583	Tankyrase-2
20	9606.ENSP00000353512	0.556	Poly [ADP-ribose] polymerase 9

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0016799	1.000	hydrolase activity, hydrolyzing N-glycosyl compounds
GO:0004649	1.000	poly(ADP-ribose) glycohydrolase activity
GO:0005488	0.999	binding
GO:0046872	0.989	metal ion binding
GO:0005515	0.983	protein binding
GO:0000287	0.983	magnesium ion binding
GO:0140292	0.942	ADP-ribosylserine hydrolase activity
GO:0019213	0.733	deacetylase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.997	organic substance metabolic process
GO:0044238	0.996	primary metabolic process
GO:0051716	0.995	cellular response to stimulus
GO:0000305	0.995	response to oxygen radical
GO:0034599	0.994	cellular response to oxidative stress
GO:0043170	0.991	macromolecule metabolic process
GO:1901564	0.985	organonitrogen compound metabolic process
GO:0036211	0.957	protein modification process
GO:0034614	0.950	cellular response to reactive oxygen species
GO:0000303	0.927	response to superoxide
GO:0071451	0.920	cellular response to superoxide
GO:0044237	0.876	cellular metabolic process
GO:0050789	0.822	regulation of biological process
GO:0050794	0.676	regulation of cellular process
GO:0006139	0.668	nucleobase-containing compound metabolic process
GO:0006281	0.508	DNA repair
GO:0048519	0.410	negative regulation of biological process
GO:0048523	0.348	negative regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0005739	0.996	mitochondrion
GO:0031981	0.990	nuclear lumen
GO:0005654	0.984	nucleoplasm
GO:0043232	0.955	intracellular non-membrane-bounded organelle
GO:0005694	0.801	chromosome
GO:0090734	0.583	site of DNA damage
GO:0005829	0.510	cytosol
GO:0005759	0.445	mitochondrial matrix
GO:0016604	0.441	nuclear body

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.2.2.-	1.000	Hydrolyzing N-glycosyl compounds.
RHEA:52216	1.000	[(1''->2')-ADP-alpha-D-ribose](n) + H2O = [(1''->2')-ADP-alpha-D-ribose](n-1) + ADP-D-ribose
EC:3.2.1.143	1.000	poly(ADP-ribose) glycohydrolase.

[back to server]