StarFunc result for job id Q9NX47

User Input

>input (278 residues)
MPDQALQQMLDRSCWVCFATDEDDRTAEWVRPCRCRGSTKWVHQACLQRWVDEKQRGNST
ARVACPQCNAEYLIVFPKLGPVVYVLDLADRLISKACPFAAAGIMVGSIYWTAVTYGAVT
VMQVVGHKEGLDVMERADPLFLLIGLPTIPVMLILGKMIRWEDYVLRLWRKYSNKLQILN
SIFPGIGCPVPRIPAEANPLADHVSATRILCGALVFPTIATIVGKLMFSSVNSNLQRTIL
GGIAFVAIKGAFKVYFKQQQYLRQAHRKILNYPEQEEA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9NX47	1.000	1.000	2.595E-46	278	1.000	1.000	Q9NX47.pdb.gz	MARH5_HUMAN E3 ubiquitin-protein ligase MARCHF5 OS=Homo sapiens OX=9606 GN=MARCHF5 PE=1 SV=1
2	AFDB:Q57V79	0.268	0.129	2.065E-4	873	0.176	0.056	Q57V79.pdb.gz	Q57V79_TRYB2 RING-CH-type domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.30P3.100 PE=4 SV=1
3	AFDB:P40318	0.222	0.059	4.221E-4	1319	0.180	0.038	P40318.pdb.gz	DOA10_YEAST ERAD-associated E3 ubiquitin-protein ligase DOA10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SSM4 PE=1 SV=1
4	AFDB:Q1LVZ2	0.214	0.234	9.112E-4	249	0.126	0.141	Q1LVZ2.pdb.gz	MARH2_DANRE E3 ubiquitin-protein ligase MARCHF2 OS=Danio rerio OX=7955 GN=marchf2 PE=2 SV=1
5	AFDB:O60103	0.305	0.086	4.020E-3	1242	0.180	0.040	O60103.pdb.gz	DOA10_SCHPO ERAD-associated E3 ubiquitin-protein ligase doa10 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=doa10 PE=1 SV=1
6	AFDB:F4JKK0	0.304	0.106	4.741E-3	1108	0.183	0.046	F4JKK0.pdb.gz	SUD1_ARATH Probable E3 ubiquitin ligase SUD1 OS=Arabidopsis thaliana OX=3702 GN=SUD1 PE=1 SV=1
7	AFDB:B8A530	0.194	0.192	6.241E-3	282	0.112	0.110	B8A530.pdb.gz	B8A530_DANRE E3 ubiquitin-protein ligase MARCH8 isoform 1 OS=Danio rerio OX=7955 GN=march8 PE=4 SV=1
8	AFDB:Q580M0	0.231	0.107	1.504E-2	866	0.201	0.065	Q580M0.pdb.gz	Q580M0_TRYB2 Zn-finger domain protein, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb03.26J7.380 PE=4 SV=1
9	AFDB:O60337	0.272	0.109	1.874E-2	910	0.133	0.041	O60337.pdb.gz	MARH6_HUMAN E3 ubiquitin-protein ligase MARCHF6 OS=Homo sapiens OX=9606 GN=MARCHF6 PE=1 SV=2
10	AFDB:Q9SN83	0.190	0.184	2.210E-2	288	0.140	0.135	Q9SN83.pdb.gz	Q9SN83_ARATH RING/FYVE/PHD zinc finger superfamily protein OS=Arabidopsis thaliana OX=3702 GN=F1P2.100 PE=1 SV=1
11	PDB:6pvpA	0.126	0.070	5.031E-1	661	0.083	0.035	6pvpA.pdb.gz
12	PDB:4u4tA	0.123	0.091	8.252E-1	444	0.115	0.072	4u4tA.pdb.gz	Structural basis for dynamic mechanism of nitrate/nitrite antiport by NarK
13	PDB:1jr3D	0.124	0.105	9.211E-1	338	0.112	0.092	1jr3D.pdb.gz	Crystal structure of the processivity clamp loader gamma (gamma) complex of E. coli DNA polymerase III.
14	PDB:5l4kQ	0.097	0.066	1.086	422	0.018	0.012	5l4kQ.pdb.gz
15	PDB:7finR	0.143	0.114	1.686	380	0.108	0.079	7finR.pdb.gz	Structural insights into multiplexed pharmacological actions of tirzepatide and peptide 20 at the GIP, GLP-1 or glucagon receptors.
16	PDB:3qe7A	0.138	0.103	1.782	407	0.115	0.079	3qe7A.pdb.gz	Structure and mechanism of the uracil transporter UraA
17	PDB:7nb6A	0.143	0.127	1.782	340	0.090	0.074	7nb6A.pdb.gz
18	PDB:4iu8B	0.125	0.091	1.989	427	0.094	0.061	4iu8B.pdb.gz	Structure and mechanism of a nitrate transporter.
19	PDB:4p9uE	0.118	0.119	1.989	272	0.097	0.099	4p9uE.pdb.gz	The 40-residue insertion in Vibrio cholerae FadR facilitates binding of an additional fatty acyl-CoA ligand.
20	PDB:6o58A	0.093	0.095	1.989	273	0.122	0.125	6o58A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9NX47	0.0	577	278	1.000	1.000	MARH5_HUMAN E3 ubiquitin-protein ligase MARCHF5 OS=Homo sapiens OX=9606 GN=MARCHF5 PE=1 SV=1
2	Q580M0	5.50e-07	52.8	866	0.097	0.031	Q580M0_TRYB2 Zn-finger domain protein, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb03.26J7.380 PE=4 SV=1
3	Q9DBD2	2.90e-04	43.9	286	0.090	0.087	MARH8_MOUSE E3 ubiquitin-protein ligase MARCHF8 OS=Mus musculus OX=10090 GN=Marchf8 PE=2 SV=1
4	Q5T0T0	3.34e-04	43.5	291	0.086	0.082	MARH8_HUMAN E3 ubiquitin-protein ligase MARCHF8 OS=Homo sapiens OX=9606 GN=MARCHF8 PE=1 SV=1
5	P40318	3.46e-04	44.3	1319	0.076	0.016	DOA10_YEAST ERAD-associated E3 ubiquitin-protein ligase DOA10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SSM4 PE=1 SV=1
6	Q9SN83	3.60e-04	43.5	288	0.076	0.073	Q9SN83_ARATH RING/FYVE/PHD zinc finger superfamily protein OS=Arabidopsis thaliana OX=3702 GN=F1P2.100 PE=1 SV=1
7	Q9LS14	4.66e-04	43.1	259	0.072	0.077	Q9LS14_ARATH At5g38070 OS=Arabidopsis thaliana OX=3702 GN=At5g38070 PE=2 SV=1
8	B8A530	5.03e-04	43.1	282	0.086	0.085	B8A530_DANRE E3 ubiquitin-protein ligase MARCH8 isoform 1 OS=Danio rerio OX=7955 GN=march8 PE=4 SV=1
9	Q9FJJ6	5.35e-04	43.1	307	0.079	0.072	Q9FJJ6_ARATH AT5g62460/K19B1_7 OS=Arabidopsis thaliana OX=3702 GN=RZFP PE=1 SV=1
10	Q57V79	0.001	42.7	873	0.101	0.032	Q57V79_TRYB2 RING-CH-type domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.30P3.100 PE=4 SV=1
11	Q9P2E8	0.001	42.0	410	0.065	0.044	MARH4_HUMAN E3 ubiquitin-protein ligase MARCHF4 OS=Homo sapiens OX=9606 GN=MARCHF4 PE=2 SV=2
12	D6REN1	0.002	40.4	141	0.079	0.156	D6REN1_HUMAN Membrane associated ring-CH-type finger 1 (Fragment) OS=Homo sapiens OX=9606 GN=MARCHF1 PE=1 SV=1
13	D6RGC4	0.002	42.0	545	0.079	0.040	D6RGC4_HUMAN Membrane associated ring-CH-type finger 1 OS=Homo sapiens OX=9606 GN=MARCHF1 PE=1 SV=1
14	Q86YJ5	0.002	41.6	346	0.065	0.052	MARH9_HUMAN E3 ubiquitin-protein ligase MARCHF9 OS=Homo sapiens OX=9606 GN=MARCHF9 PE=1 SV=2
15	Q9XF50	0.002	41.2	218	0.054	0.069	Q9XF50_ARATH At4g02075 OS=Arabidopsis thaliana OX=3702 GN=PIT1 PE=2 SV=1
16	O60103	0.003	41.2	1242	0.068	0.015	DOA10_SCHPO ERAD-associated E3 ubiquitin-protein ligase doa10 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=doa10 PE=1 SV=1
17	Q6NZQ8	0.003	40.8	289	0.079	0.076	MARH1_MOUSE E3 ubiquitin-protein ligase MARCHF1 OS=Mus musculus OX=10090 GN=Marchf1 PE=1 SV=2
18	Q8TCQ1	0.003	40.8	289	0.079	0.076	MARH1_HUMAN E3 ubiquitin-protein ligase MARCHF1 OS=Homo sapiens OX=9606 GN=MARCHF1 PE=1 SV=1
19	Q4PS45	0.007	39.7	265	0.061	0.064	Q4PS45_ARATH At1g14260 OS=Arabidopsis thaliana OX=3702 GN=At1g14260 PE=2 SV=1
20	Q381G2	0.009	40.0	1111	0.065	0.016	Q381G2_TRYB2 RING-CH-type domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.7920 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF10725 DUF2517	4.6	18.5	Protein of unknown function (DUF2517)
2	PF11793 FANCL_C	1.1e+02	14.4	FANCL C-terminal domain
3	PF12906 RINGv	4.1e-11	54.2	RING-variant domain
4	PF13639 zf-RING_2	10	17.9	Ring finger domain
5	PF14570 zf-RING_4	8e+02	11.2	RING/Ubox like zinc-binding domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 1026970.XP_008847827.1

Rank	PPI partner	STRING score	Description
1	1026970.XP_008848156.1	0.808	Mitofusin-2
2	1026970.XP_008827870.1	0.746	Dynamin 1 like
3	1026970.XP_008836888.1	0.736	Mitofusin 1
4	1026970.XP_008840262.1	0.708	FUN14 domain containing 2
5	1026970.XP_008847574.1	0.663	FUN14 domain-containing protein 1
6	1026970.XP_008824377.1	0.651	Ubiquitin-conjugating enzyme E2 D3
7	1026970.XP_008846076.1	0.651	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 mRNA, 1 EST, 52 Proteins, and 88% coverage of the annotated genomic feature by RNAseq alignments
8	1026970.XP_008831376.1	0.637	Ubiquitin conjugating enzyme E2 E1
9	1026970.XP_008851947.1	0.631	PGAM family member 5, mitochondrial serine/threonine protein phosphatase
10	1026970.XP_008836808.1	0.629	Mitochondrial ubiquitin ligase activator of NFKB 1 isoform X1
11	1026970.XP_008839242.1	0.619	Ring finger protein 185
12	1026970.XP_008842791.1	0.611	Membrane associated ring-CH-type finger 2
13	1026970.XP_008845717.1	0.611	DEAD-box helicase 54
14	1026970.XP_008824824.1	0.576	Fission, mitochondrial 1
15	1026970.XP_008839196.1	0.561	Membrane associated ring-CH-type finger 3
16	1026970.XP_008843948.1	0.557	Membrane associated ring-CH-type finger 7
17	1026970.XP_008842509.1	0.554	Ubiquitin conjugating enzyme E2 D2
18	1026970.XP_008826180.1	0.552	Ubiquitin-conjugating enzyme E2 E3
19	1026970.XP_008824065.1	0.544	Mitochondrial fission factor
20	1026970.XP_008845297.1	0.537	Ring finger protein 144B

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0051020	1.000	GTPase binding
GO:0061630	1.000	ubiquitin protein ligase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.997	cellular process
GO:0008152	0.995	metabolic process
GO:0050789	0.987	regulation of biological process
GO:0019538	0.986	protein metabolic process
GO:0048522	0.981	positive regulation of cellular process
GO:0010821	0.978	regulation of mitochondrion organization
GO:0022603	0.972	regulation of anatomical structure morphogenesis
GO:0051641	0.970	cellular localization
GO:0010822	0.968	positive regulation of mitochondrion organization
GO:0032446	0.967	protein modification by small protein conjugation
GO:0051865	0.964	protein autoubiquitination
GO:0000209	0.949	protein polyubiquitination
GO:0090140	0.936	regulation of mitochondrial fission
GO:0008104	0.933	protein localization
GO:0070585	0.923	protein localization to mitochondrion
GO:0051094	0.492	positive regulation of developmental process
GO:0071840	0.371	cellular component organization or biogenesis
GO:0050896	0.346	response to stimulus
GO:0016043	0.341	cellular component organization
GO:0044237	0.326	cellular metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005741	0.998	mitochondrial outer membrane
GO:0005789	0.995	endoplasmic reticulum membrane
GO:0070013	0.417	intracellular organelle lumen
GO:0032991	0.308	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	1.000	Transferases.

[back to server]