StarFunc result for job id Q9NX55

User Input

>input (129 residues)
MRRRGEIDMATEGDVELELETETSGPERPPEKPRKHDSGAADLERVTDYAEEKEIQSSNL
ETAMSVIGDRRSREQKAKQEREKELAKVTIKKEDLELIMTEMEISRAAAERSLREHMGNV
VEALIALTN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9CR41	0.504	0.504	9.681E-16	129	0.992	0.992	Q9CR41.pdb.gz	HYPK_MOUSE Huntingtin-interacting protein K OS=Mus musculus OX=10090 GN=Hypk PE=1 SV=3
2	PDB:6c95D	0.476	0.622	2.070E-10	95	0.736	1.000	6c95D.pdb.gz	Structure of Human NatA and Its Regulation by the Huntingtin Interacting Protein HYPK.
3	AFDB:Q9C901	0.460	0.508	7.185E-6	115	0.279	0.313	Q9C901.pdb.gz	Q9C901_ARATH DNA-binding enhancer protein-like protein OS=Arabidopsis thaliana OX=3702 GN=At3g06610 PE=1 SV=1
4	PDB:7qwqt	0.302	0.736	1.391E-1	47	0.116	0.319	7qwqt.pdb.gz	Mechanism of signal sequence handover from NAC to SRP on ribosomes during ER-protein targeting.
5	AFDB:Q9SJR4	0.205	0.147	7.679E-1	195	0.171	0.113	Q9SJR4.pdb.gz	Q9SJR4_ARATH RAB6-interacting golgin OS=Arabidopsis thaliana OX=3702 GN=At2g36410 PE=1 SV=2
6	PDB:4xb6C	0.253	0.096	1.537	353	0.093	0.034	4xb6C.pdb.gz	Structural insights into the bacterial carbon-phosphorus lyase machinery.
7	PDB:3ihpB	0.269	0.056	1.738	681	0.070	0.013	3ihpB.pdb.gz	Covalent Ubiquitin-Usp5 Complex
8	AFDB:Q9FTQ1	0.259	0.159	2.327	267	0.140	0.067	Q9FTQ1.pdb.gz	Q9FTQ1_ORYSJ Os01g0218100 protein OS=Oryza sativa subsp. japonica OX=39947 GN=Os01g0218100 PE=3 SV=1
9	PDB:3e46A	0.257	0.167	2.675	202	0.054	0.035	3e46A.pdb.gz
10	PDB:3bq3A	0.276	0.143	2.845	250	0.047	0.024	3bq3A.pdb.gz
11	AFDB:F4IF85	0.264	0.090	2.977	395	0.116	0.038	F4IF85.pdb.gz	F4IF85_ARATH Ubiquitin receptor RAD23 OS=Arabidopsis thaliana OX=3702 GN=RAD23B PE=1 SV=1
12	AFDB:Q9NZL4	0.246	0.104	3.166	359	0.163	0.058	Q9NZL4.pdb.gz	HPBP1_HUMAN Hsp70-binding protein 1 OS=Homo sapiens OX=9606 GN=HSPBP1 PE=1 SV=2
13	PDB:6o8qB	0.179	0.249	3.218	91	0.054	0.077	6o8qB.pdb.gz	Nucleoid remodeling during environmental adaptation is regulated by HU-dependent DNA bundling.
14	AFDB:Q2HIU0	0.237	0.128	3.367	266	0.225	0.109	Q2HIU0.pdb.gz	Q2HIU0_ARATH At3g15110 OS=Arabidopsis thaliana OX=3702 GN=At3g15110 PE=1 SV=1
15	AFDB:Q8IV48	0.176	0.084	3.367	349	0.147	0.054	Q8IV48.pdb.gz	ERI1_HUMAN 3'-5' exoribonuclease 1 OS=Homo sapiens OX=9606 GN=ERI1 PE=1 SV=3
16	AFDB:Q9US54	0.212	0.155	3.581	199	0.101	0.065	Q9US54.pdb.gz	TAF11_SCHPO Transcription initiation factor TFIID subunit 11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=taf11 PE=3 SV=1
17	AFDB:Q9VZI2	0.256	0.036	3.581	1073	0.147	0.018	Q9VZI2.pdb.gz	ACK_DROME Activated Cdc42 kinase Ack OS=Drosophila melanogaster OX=7227 GN=Ack PE=1 SV=2
18	PDB:4yewC	0.194	0.342	3.640	71	0.054	0.099	4yewC.pdb.gz	HU multimerization shift controls nucleoid compaction.
19	PDB:4yftA	0.180	0.299	3.871	76	0.085	0.145	4yftA.pdb.gz	HU multimerization shift controls nucleoid compaction.
20	PDB:4f1iA	0.289	0.117	5.602	328	0.054	0.021	4f1iA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9CR41	6.34e-82	238	121	0.938	1.000	HYPK_MOUSE Huntingtin-interacting protein K OS=Mus musculus OX=10090 GN=Hypk PE=1 SV=3
2	Q9NX55	6.34e-82	238	121	0.938	1.000	HYPK_HUMAN Huntingtin-interacting protein K OS=Homo sapiens OX=9606 GN=HYPK PE=1 SV=3
3	Q9C901	4.48e-15	68.2	115	0.271	0.304	Q9C901_ARATH DNA-binding enhancer protein-like protein OS=Arabidopsis thaliana OX=3702 GN=At3g06610 PE=1 SV=1
4	P87147	0.003	38.1	173	0.140	0.104	NACA_SCHPO Nascent polypeptide-associated complex subunit alpha OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=egd2 PE=1 SV=1
5	Q94JX9	0.003	38.1	217	0.109	0.065	NACA2_ARATH Nascent polypeptide-associated complex subunit alpha-like protein 2 OS=Arabidopsis thaliana OX=3702 GN=At3g49470 PE=2 SV=2
6	O15069	0.014	36.6	1562	0.116	0.010	NACAD_HUMAN NAC-alpha domain-containing protein 1 OS=Homo sapiens OX=9606 GN=NACAD PE=1 SV=3
7	P70670	0.015	36.6	2187	0.109	0.006	NACAM_MOUSE Nascent polypeptide-associated complex subunit alpha, muscle-specific form OS=Mus musculus OX=10090 GN=Naca PE=1 SV=2
8	Q13765	0.016	36.2	215	0.109	0.065	NACA_HUMAN Nascent polypeptide-associated complex subunit alpha OS=Homo sapiens OX=9606 GN=NACA PE=1 SV=1
9	Q60817	0.016	36.2	215	0.109	0.065	NACA_MOUSE Nascent polypeptide-associated complex subunit alpha OS=Mus musculus OX=10090 GN=Naca PE=1 SV=1
10	Q8JIU7	0.018	35.8	215	0.109	0.065	NACA_DANRE Nascent polypeptide-associated complex subunit alpha OS=Danio rerio OX=7955 GN=naca PE=1 SV=1
11	Q9SZY1	0.021	35.8	212	0.109	0.066	NACA4_ARATH Nascent polypeptide-associated complex subunit alpha-like protein 4 OS=Arabidopsis thaliana OX=3702 GN=At4g10480 PE=1 SV=1
12	P38879	0.034	35.0	174	0.093	0.069	NACA_YEAST Nascent polypeptide-associated complex subunit alpha OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=EGD2 PE=1 SV=3
13	Q5ANP2	0.035	35.0	178	0.101	0.073	NACA_CANAL Nascent polypeptide-associated complex subunit alpha OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=EGD2 PE=3 SV=1
14	Q9LHG9	0.083	33.9	203	0.109	0.069	NACA1_ARATH Nascent polypeptide-associated complex subunit alpha-like protein 1 OS=Arabidopsis thaliana OX=3702 GN=At3g12390 PE=1 SV=1
15	Q6FJD5	0.23	32.3	165	0.078	0.061	NACA_CANGA Nascent polypeptide-associated complex subunit alpha OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=EGD2 PE=3 SV=1
16	Q6ICZ8	0.43	32.0	204	0.101	0.064	NACA3_ARATH Nascent polypeptide-associated complex subunit alpha-like protein 3 OS=Arabidopsis thaliana OX=3702 GN=At5g13850 PE=1 SV=1
17	Q86S66	0.81	31.2	195	0.101	0.067	NACA_CAEEL Nascent polypeptide-associated complex subunit alpha OS=Caenorhabditis elegans OX=6239 GN=icd-2 PE=1 SV=2
18	O05838	3.9	28.9	142	0.147	0.134	O05838_MYCTU Uncharacterized protein OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv2360c PE=1 SV=1
19	Q03002	4.6	29.3	865	0.132	0.020	FRK1_YEAST Fatty acyl-CoA synthetase and RNA processing-associated kinase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=FRK1 PE=1 SV=1
20	Q00174	5.4	29.3	3712	0.163	0.006	LAMA_DROME Laminin subunit alpha OS=Drosophila melanogaster OX=7227 GN=LanA PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF19026 HYPK_UBA	6.5e-17	71.9	HYPK UBA domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61622.XP_010383547.1

Rank	PPI partner	STRING score	Description
1	61622.XP_010351783.1	0.980	N(alpha)-acetyltransferase 15, NatA auxiliary subunit
2	61622.XP_010360033.1	0.934	N(alpha)-acetyltransferase 10, NatA catalytic subunit
3	61622.XP_010372807.1	0.887	N(alpha)-acetyltransferase 16, NatA auxiliary subunit
4	61622.XP_010358140.1	0.870	N(alpha)-acetyltransferase 11, NatA catalytic subunit
5	61622.XP_010359320.1	0.867	N(alpha)-acetyltransferase 50, NatE catalytic subunit
6	61622.XP_010382700.1	0.861	Huntingtin
7	61622.XP_010374348.1	0.823	N(alpha)-acetyltransferase 60, NatF catalytic subunit
8	61622.XP_010379789.1	0.809	Lysine acetyltransferase 14
9	61622.XP_010373151.1	0.740	Mitochondrial import inner membrane translocase subunit Tim13
10	61622.XP_010375448.1	0.740	Mitochondrial import inner membrane translocase subunit Tim13
11	61622.XP_010373273.1	0.735	Peptidylprolyl cis/trans isomerase, NIMA-interacting 4
12	61622.XP_010351164.1	0.728	Cytochrome b-c1 complex subunit 6, mitochondrial
13	61622.XP_010361331.1	0.728	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 11 mRNAs, 688 ESTs, 5 Proteins, and 91% coverage of the annotated genomic feature by RNAseq alignments, including 1 sample with support for all annotated introns
14	61622.XP_010351699.1	0.726	Mitochondrial import inner membrane translocase subunit Tim10
15	61622.XP_010365420.1	0.723	Prefoldin subunit 2
16	61622.XP_010385465.1	0.720	Belongs to the peptidase T1B family.
17	61622.XP_010354409.1	0.704	Mitochondrial ribosomal protein L43
18	61622.XP_010367771.1	0.672	Belongs to the universal ribosomal protein uL13 family.
19	61622.XP_010372090.1	0.672	RNA-binding component of the eukaryotic translation initiation factor 3 (eIF-3) complex, which is required for several steps in the initiation of protein synthesis. The eIF-3 complex associates with the 40S ribosome and facilitates the recruitment of eIF-1, eIF-1A, eIF-2:GTP:methionyl-tRNAi and eIF-5 to form the 43S pre- initiation complex (43S PIC). The eIF-3 complex stimulates mRNA recruitment to the 43S PIC and scanning of the mRNA for AUG recognition. The eIF-3 complex is also required for disassembly and recycling of post-termination ribosomal complexes and subsequently prevents p [...]
20	61622.XP_010350847.1	0.661	Belongs to the bacterial ribosomal protein bL20 family.

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0044183	0.486	protein folding chaperone
GO:0003824	0.338	catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065007	0.995	biological regulation
GO:0031647	0.991	regulation of protein stability
GO:0010941	0.985	regulation of cell death
GO:0060548	0.976	negative regulation of cell death
GO:0043069	0.973	negative regulation of programmed cell death
GO:0043066	0.963	negative regulation of apoptotic process
GO:0050821	0.944	protein stabilization
GO:0009987	0.637	cellular process
GO:0071704	0.391	organic substance metabolic process
GO:0006807	0.336	nitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0032991	0.998	protein-containing complex
GO:0005654	0.998	nucleoplasm
GO:0043232	0.994	intracellular non-membrane-bounded organelle
GO:0005829	0.952	cytosol
GO:0005856	0.781	cytoskeleton
GO:0015630	0.501	microtubule cytoskeleton

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]