StarFunc result for job id Q9NX58

User Input

>input (379 residues)
MVFFTCNACGESVKKIQVEKHVSVCRNCECLSCIDCGKDFWGDDYKNHVKCISEDQKYGG
KGYEGKTHKGDIKQQAWIQKISELIKRPNVSPKVRELLEQISAFDNVPRKKAKFQNWMKN
SLKVHNESILDQVWNIFSEASNSEPVNKEQDQRPLHPVANPHAEISTKVPASKVKDAVEQ
QGEVKKNKRERKEERQKKRKREKKELKLENHQENSRNQKPKKRKKGQEADLEAGGEEVPE
ANGSAGKRSKKKKQRKDSASEEEAHVGAGKRKRRHSEVETDSKKKKMKLPEHPEGGEPED
DEAPAKGKFNWKGTIKAILKQAPDNEITIKKLRKKVLAQYYTVTDEHHRSEEELLVIFNK
KISKNPTFKLLKDKVKLVK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9NX58	1.000	1.000	1.700E-59	379	1.000	1.000	Q9NX58.pdb.gz	LYAR_HUMAN Cell growth-regulating nucleolar protein OS=Homo sapiens OX=9606 GN=LYAR PE=1 SV=3
2	AFDB:Q08288	0.506	0.495	4.587E-45	388	0.736	0.719	Q08288.pdb.gz	LYAR_MOUSE Cell growth-regulating nucleolar protein OS=Mus musculus OX=10090 GN=Lyar PE=1 SV=2
3	PDB:6zmiCE	0.189	0.976	8.895E-10	72	0.190	1.000	6zmiCE.pdb.gz	Structural basis for translational shutdown and immune evasion by the Nsp1 protein of SARS-CoV-2.
4	AFDB:O16850	0.169	0.122	4.980E-2	541	0.074	0.052	O16850.pdb.gz	FOXO_CAEEL Forkhead box protein O OS=Caenorhabditis elegans OX=6239 GN=daf-16 PE=1 SV=3
5	AFDB:P55316	0.154	0.121	5.948E-2	489	0.087	0.067	P55316.pdb.gz	FOXG1_HUMAN Forkhead box protein G1 OS=Homo sapiens OX=9606 GN=FOXG1 PE=1 SV=2
6	AFDB:O75122	0.112	0.046	7.105E-2	1294	0.116	0.034	O75122.pdb.gz	CLAP2_HUMAN CLIP-associating protein 2 OS=Homo sapiens OX=9606 GN=CLASP2 PE=1 SV=3
7	AFDB:A5PN09	0.091	0.048	7.999E-2	911	0.121	0.050	A5PN09.pdb.gz	UBP20_DANRE Ubiquitin carboxyl-terminal hydrolase 20 OS=Danio rerio OX=7955 GN=usp20 PE=3 SV=1
8	AFDB:Q8K3Q3	0.159	0.119	9.554E-2	521	0.087	0.063	Q8K3Q3.pdb.gz	FOXN4_MOUSE Forkhead box protein N4 OS=Mus musculus OX=10090 GN=Foxn4 PE=1 SV=1
9	AFDB:Q9SF04	0.088	0.070	1.076E-1	572	0.137	0.091	Q9SF04.pdb.gz	Q9SF04_ARATH F26K24.24 protein OS=Arabidopsis thaliana OX=3702 GN=F26K24.24 PE=1 SV=1
10	AFDB:Q09530	0.127	0.051	1.363E-1	1200	0.090	0.028	Q09530.pdb.gz	MOG5_CAEEL Probable pre-mRNA-splicing factor ATP-dependent RNA helicase mog-5 OS=Caenorhabditis elegans OX=6239 GN=mog-5 PE=1 SV=1
11	AFDB:Q3LRZ3	0.080	0.076	1.535E-1	400	0.084	0.080	Q3LRZ3.pdb.gz	AXLP1_CAEEL Axin-like protein 1 OS=Caenorhabditis elegans OX=6239 GN=axl-1 PE=1 SV=1
12	PDB:4fjcE	0.093	0.086	2.741E-1	434	0.063	0.055	4fjcE.pdb.gz	A Role for Intersubunit Interactions in Maintaining SAGA Deubiquitinating Module Structure and Activity.
13	PDB:4wa6D	0.077	0.071	1.279	415	0.074	0.067	4wa6D.pdb.gz	Structure of yeast SAGA DUBm with Sgf73 N59D mutant at 2.36 angstroms resolution
14	PDB:5iy7M	0.102	0.117	1.439	310	0.045	0.055	5iy7M.pdb.gz	Near-atomic resolution visualization of human transcription promoter opening.
15	PDB:2zm5A	0.083	0.098	1.620	306	0.029	0.036	2zm5A.pdb.gz	Snapshots of dynamics in synthesizing N(6)-isopentenyladenosine at the tRNA anticodon
16	PDB:5xtbH	0.105	0.291	1.719	112	0.042	0.143	5xtbH.pdb.gz	Architecture of Human Mitochondrial Respiratory Megacomplex I2III2IV2.
17	PDB:7qskV	0.107	0.291	1.824	115	0.040	0.130	7qskV.pdb.gz	Cryo-EM structures define ubiquinone-10 binding to mitochondrial complex I and conformational transitions accompanying Q-site occupancy.
18	PDB:3j6bL	0.096	0.136	1.936	229	0.034	0.057	3j6bL.pdb.gz	Structure of the yeast mitochondrial large ribosomal subunit.
19	PDB:3hybA	0.130	0.316	2.054	115	0.013	0.043	3hybA.pdb.gz
20	PDB:4mtdD	0.132	0.276	2.054	151	0.024	0.060	4mtdD.pdb.gz	Structural and Mechanistic Basis of Zinc Regulation Across the E. coli Zur Regulon.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q08288	0.0	516	388	0.736	0.719	LYAR_MOUSE Cell growth-regulating nucleolar protein OS=Mus musculus OX=10090 GN=Lyar PE=1 SV=2
2	Q9NX58	0.0	764	379	0.997	0.997	LYAR_HUMAN Cell growth-regulating nucleolar protein OS=Homo sapiens OX=9606 GN=LYAR PE=1 SV=3
3	D6RDJ1	3.91e-54	175	79	0.208	1.000	D6RDJ1_HUMAN Ly1 antibody reactive (Fragment) OS=Homo sapiens OX=9606 GN=LYAR PE=1 SV=1
4	P37263	2.78e-10	60.5	153	0.084	0.209	YC16_YEAST UPF0743 protein YCR087C-A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YCR087C-A PE=1 SV=1
5	O94311	2.61e-08	55.5	180	0.061	0.128	YH56_SCHPO UPF0743 protein C215.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC215.06c PE=1 SV=2
6	Q57WD3	9.62e-07	52.4	297	0.066	0.084	Q57WD3_TRYB2 Zinc finger C2H2 LYAR-type domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb03.28C22.230 PE=4 SV=1
7	Q9QZM6	0.92	34.3	1181	0.082	0.026	NCKX1_RAT Sodium/potassium/calcium exchanger 1 OS=Rattus norvegicus OX=10116 GN=Slc24a1 PE=2 SV=1
8	M9PE28	3.6	32.3	1641	0.074	0.017	M9PE28_DROME THO complex subunit 2 OS=Drosophila melanogaster OX=7227 GN=tho2 PE=1 SV=1
9	E2QCS8	3.8	32.3	1642	0.074	0.017	E2QCS8_DROME THO complex subunit 2 OS=Drosophila melanogaster OX=7227 GN=tho2 PE=1 SV=1
10	Q9VQ76	3.8	32.3	1641	0.077	0.018	Q9VQ76_DROME THO complex subunit 2 OS=Drosophila melanogaster OX=7227 GN=tho2 PE=1 SV=2
11	F1SHI5	4.7	32.0	1557	0.087	0.021	F1SHI5_PIG Bromodomain adjacent to zinc finger domain 1A OS=Sus scrofa OX=9823 GN=BAZ1A PE=4 SV=2
12	Q96JG9	7.6	31.2	3925	0.055	0.005	ZN469_HUMAN Zinc finger protein 469 OS=Homo sapiens OX=9606 GN=ZNF469 PE=2 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08766 DEK_C	33	15.8	DEK C terminal domain
2	PF16276 NPM1-C	56	15.2	Nucleophosmin C-terminal domain
3	PF17848 zf-ACC	0.00072	31.0	Acetyl-coA carboxylase zinc finger domain
4	PF08790 zf-LYAR	3.6e-12	57.2	LYAR-type C2HC zinc finger

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000345917

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000202816	0.931	ESF1 homolog
2	9606.ENSP00000339145	0.928	Ribosomal RNA processing protein 1 homolog B
3	9606.ENSP00000238146	0.926	ATP-dependent RNA helicase DDX55
4	9606.ENSP00000320917	0.923	KRI1 homolog
5	9606.ENSP00000322396	0.922	Ribosome biogenesis regulatory protein homolog
6	9606.ENSP00000357748	0.917	BRCA2 and CDKN1A-interacting protein
7	9606.ENSP00000405068	0.915	Nucleolar protein 14
8	9606.ENSP00000338862	0.909	Ribosome biogenesis protein BRX1 homolog
9	9606.ENSP00000302886	0.902	Proliferation-associated protein 2G4
10	9606.ENSP00000229214	0.899	KRR1 small subunit processome component homolog
11	9606.ENSP00000254940	0.899	60S ribosome subunit biogenesis protein NIP7 homolog
12	9606.ENSP00000285814	0.893	Nucleolar protein interacting with the FHA domain of MKI67
13	9606.ENSP00000264279	0.892	Nucleolar protein 58
14	9606.ENSP00000407323	0.890	Probable rRNA-processing protein EBP2
15	9606.ENSP00000362153	0.886	Nucleolar GTP-binding protein 2
16	9606.ENSP00000387365	0.886	Periodic tryptophan protein 1 homolog
17	9606.ENSP00000258772	0.884	Probable ATP-dependent RNA helicase DDX56
18	9606.ENSP00000274606	0.881	H/ACA ribonucleoprotein complex subunit 2
19	9606.ENSP00000346725	0.881	Pescadillo homolog
20	9606.ENSP00000402338	0.881	Ribosome production factor 2 homolog

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0140416	1.000	transcription regulator inhibitor activity
GO:0042802	1.000	identical protein binding
GO:0140297	1.000	DNA-binding transcription factor binding
GO:0003723	1.000	RNA binding
GO:0003677	1.000	DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0044238	0.989	primary metabolic process
GO:0043170	0.988	macromolecule metabolic process
GO:0034641	0.985	cellular nitrogen compound metabolic process
GO:0050794	0.978	regulation of cellular process
GO:0010467	0.971	gene expression
GO:0006139	0.967	nucleobase-containing compound metabolic process
GO:0048522	0.965	positive regulation of cellular process
GO:0016070	0.963	RNA metabolic process
GO:0071840	0.936	cellular component organization or biogenesis
GO:0044085	0.927	cellular component biogenesis
GO:0006396	0.926	RNA processing
GO:0022613	0.917	ribonucleoprotein complex biogenesis
GO:0034660	0.904	ncRNA metabolic process
GO:0019222	0.887	regulation of metabolic process
GO:0060255	0.875	regulation of macromolecule metabolic process
GO:0080090	0.862	regulation of primary metabolic process
GO:0051171	0.862	regulation of nitrogen compound metabolic process
GO:0031323	0.859	regulation of cellular metabolic process
GO:0010468	0.841	regulation of gene expression
GO:0042254	0.794	ribosome biogenesis
GO:0034470	0.762	ncRNA processing
GO:0006356	0.760	regulation of transcription by RNA polymerase I
GO:0010604	0.755	positive regulation of macromolecule metabolic process
GO:0048519	0.748	negative regulation of biological process
GO:0048523	0.744	negative regulation of cellular process
GO:0010605	0.724	negative regulation of macromolecule metabolic process
GO:0031324	0.682	negative regulation of cellular metabolic process
GO:0051172	0.674	negative regulation of nitrogen compound metabolic process
GO:0010558	0.635	negative regulation of macromolecule biosynthetic process
GO:0031327	0.634	negative regulation of cellular biosynthetic process
GO:0045892	0.605	negative regulation of DNA-templated transcription
GO:0006357	0.556	regulation of transcription by RNA polymerase II
GO:0000122	0.539	negative regulation of transcription by RNA polymerase II
GO:0031325	0.524	positive regulation of cellular metabolic process
GO:0016072	0.521	rRNA metabolic process
GO:0006364	0.507	rRNA processing
GO:0051173	0.442	positive regulation of nitrogen compound metabolic process
GO:0031328	0.396	positive regulation of cellular biosynthetic process
GO:0032502	0.369	developmental process
GO:0032501	0.354	multicellular organismal process
GO:0010557	0.328	positive regulation of macromolecule biosynthetic process
GO:0051254	0.323	positive regulation of RNA metabolic process
GO:0045893	0.307	positive regulation of DNA-templated transcription

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0005730	1.000	nucleolus
GO:0032991	0.912	protein-containing complex
GO:0005737	0.803	cytoplasm
GO:0005829	0.616	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]