StarFunc result for job id Q9NX61

User Input

>input (479 residues)
MAVLGVQLVVTLLTATLMHRLAPHCSFARWLLCNGSLFRYKHPSEEELRALAGKPRPRGR
KERWANGLSEEKPLSVPRDAPFQLETCPLTTVDALVLRFFLEYQWFVDFAVYSGGVYLFT
EAYYYMLGPAKETNIAVFWCLLTVTFSIKMFLTVTRLYFSAEEGGERSVCLTFAFLFLLL
AMLVQVVREETLELGLEPGLASMTQNLEPLLKKQGWDWALPVAKLAIRVGLAVVGSVLGA
FLTFPGLRLAQTHRDALTMSEDRPMLQFLLHTSFLSPLFILWLWTKPIARDFLHQPPFGE
TRFSLLSDSAFDSGRLWLLVVLCLLRLAVTRPHLQAYLCLAKARVEQLRREAGRIEAREI
QQRVVRVYCYVTVVSLQYLTPLILTLNCTLLLKTLGGYSWGLGPAPLLSPDPSSASAAPI
GSGEDEVQQTAARIAGALGGLLTPLFLRGVLAYLIWWTAACQLLASLFGLYFHQHLAGS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9NX61	1.000	1.000	1.422E-65	479	1.000	1.000	Q9NX61.pdb.gz	T161A_HUMAN Transmembrane protein 161A OS=Homo sapiens OX=9606 GN=TMEM161A PE=1 SV=1
2	AFDB:Q8C2L6	0.911	0.896	7.519E-39	487	0.493	0.485	Q8C2L6.pdb.gz	T161B_MOUSE Transmembrane protein 161B OS=Mus musculus OX=10090 GN=Tmem161b PE=2 SV=1
3	AFDB:Q7SY10	0.908	0.899	1.757E-38	484	0.472	0.467	Q7SY10.pdb.gz	T161B_DANRE Transmembrane protein 161B OS=Danio rerio OX=7955 GN=tmem161b PE=2 SV=1
4	AFDB:Q9VTF5	0.898	0.869	3.279E-33	496	0.361	0.349	Q9VTF5.pdb.gz	Q9VTF5_DROME Emei OS=Drosophila melanogaster OX=7227 GN=emei PE=2 SV=2
5	AFDB:U5NJJ9	0.131	0.179	1.863E-1	299	0.090	0.144	U5NJJ9.pdb.gz	U5NJJ9_9MICC RfiA (Fragment) OS=Arthrobacter alpinus OX=656366 GN=rfiA PE=4 SV=1
6	PDB:7e32R	0.135	0.194	2.113E-1	285	0.084	0.140	7e32R.pdb.gz	Structural insights into the lipid and ligand regulation of serotonin receptors.
7	AFDB:P30557	0.164	0.195	2.848E-1	365	0.119	0.156	P30557.pdb.gz	PE2R3_MOUSE Prostaglandin E2 receptor EP3 subtype OS=Mus musculus OX=10090 GN=Ptger3 PE=1 SV=1
8	AFDB:Q20411	0.162	0.204	3.375E-1	334	0.094	0.135	Q20411.pdb.gz	SRA11_CAEEL Serpentine receptor class alpha-11 OS=Caenorhabditis elegans OX=6239 GN=sra-11 PE=2 SV=2
9	PDB:6jb1B	0.147	0.071	4.167E-1	1366	0.100	0.035	6jb1B.pdb.gz	The Structural Basis for the Binding of Repaglinide to the Pancreatic KATPChannel.
10	AFDB:Q580H0	0.105	0.105	4.543E-1	482	0.123	0.122	Q580H0.pdb.gz	Q580H0_TRYB2 Golgi pH regulator conserved domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.29O9.220 PE=4 SV=1
11	AFDB:Q13258	0.164	0.204	4.740E-1	359	0.096	0.128	Q13258.pdb.gz	PD2R_HUMAN Prostaglandin D2 receptor OS=Homo sapiens OX=9606 GN=PTGDR PE=2 SV=2
12	PDB:7e2xR	0.162	0.238	4.938E-1	278	0.086	0.147	7e2xR.pdb.gz	Structural insights into the lipid and ligand regulation of serotonin receptors.
13	AFDB:Q94KB4	0.102	0.105	5.617E-1	460	0.100	0.104	Q94KB4.pdb.gz	MLO9_ARATH MLO-like protein 9 OS=Arabidopsis thaliana OX=3702 GN=MLO9 PE=2 SV=2
14	PDB:6g79S	0.105	0.157	7.548E-1	262	0.084	0.153	6g79S.pdb.gz	Cryo-EM structure of the serotonin 5-HT1Breceptor coupled to heterotrimeric Go.
15	PDB:5wuaE	0.139	0.068	8.573E-1	1312	0.088	0.032	5wuaE.pdb.gz
16	PDB:5lzrB	0.122	0.093	1.016	697	0.134	0.092	5lzrB.pdb.gz	Membrane pyrophosphatases from Thermotoga maritima and Vigna radiata suggest a conserved coupling mechanism.
17	PDB:2wsxA	0.137	0.134	1.106	496	0.117	0.113	2wsxA.pdb.gz	Structural Basis of Na(+)-Independent and Cooperative Substrate/Product Antiport in Cait.
18	PDB:5ykeB	0.147	0.099	1.154	845	0.119	0.067	5ykeB.pdb.gz	Ligand binding and conformational changes of SUR1 subunit in pancreatic ATP-sensitive potassium channels.
19	PDB:5lzqA	0.109	0.085	1.256	725	0.140	0.092	5lzqA.pdb.gz	Membrane pyrophosphatases from Thermotoga maritima and Vigna radiata suggest a conserved coupling mechanism.
20	PDB:5oxpA	0.123	0.127	1.256	462	0.113	0.117	5oxpA.pdb.gz	Multispecific Substrate Recognition in a Proton-Dependent Oligopeptide Transporter.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9NX61	0.0	960	479	1.000	1.000	T161A_HUMAN Transmembrane protein 161A OS=Homo sapiens OX=9606 GN=TMEM161A PE=1 SV=1
2	Q8C2L6	1.65e-162	470	487	0.495	0.487	T161B_MOUSE Transmembrane protein 161B OS=Mus musculus OX=10090 GN=Tmem161b PE=2 SV=1
3	Q7SY10	3.51e-143	421	484	0.480	0.475	T161B_DANRE Transmembrane protein 161B OS=Danio rerio OX=7955 GN=tmem161b PE=2 SV=1
4	Q9VTF5	1.78e-98	306	496	0.365	0.353	Q9VTF5_DROME Emei OS=Drosophila melanogaster OX=7227 GN=emei PE=2 SV=2
5	Q8N5C8	0.34	35.8	712	0.069	0.046	TAB3_HUMAN TGF-beta-activated kinase 1 and MAP3K7-binding protein 3 OS=Homo sapiens OX=9606 GN=TAB3 PE=1 SV=3
6	P14873	1.8	33.9	2464	0.044	0.009	MAP1B_MOUSE Microtubule-associated protein 1B OS=Mus musculus OX=10090 GN=Map1b PE=1 SV=2
7	P15205	1.8	33.9	2461	0.044	0.009	MAP1B_RAT Microtubule-associated protein 1B OS=Rattus norvegicus OX=10116 GN=Map1b PE=1 SV=3
8	Q03571	1.9	33.5	560	0.038	0.032	CPB1_CAEEL Cytoplasmic polyadenylation element-binding protein 1 OS=Caenorhabditis elegans OX=6239 GN=cpb-1 PE=1 SV=3
9	F1BVB7	3.3	32.7	543	0.040	0.035	STOX_ARGME Tetrahydroberberine oxidase OS=Argemone mexicana OX=54796 PE=1 SV=1
10	P0C896	4.1	32.3	576	0.052	0.043	PP209_ARATH Small ribosomal subunit protein mS80 (rPPR6) OS=Arabidopsis thaliana OX=3702 GN=At3g02650 PE=1 SV=1
11	A0A087X2I4	7.8	30.8	213	0.042	0.094	A0A087X2I4_HUMAN Proteasome subunit beta OS=Homo sapiens OX=9606 GN=PSMB6 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF10268 Tmemb_161AB	2.6e-193	654.7	Predicted transmembrane protein 161AB

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000162044

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000064778	0.786	Protein FAM168A
2	9606.ENSP00000326693	0.766	Mitochondrial coenzyme A transporter SLC25A42
3	9606.ENSP00000325355	0.724	Caskin-2
4	9606.ENSP00000284000	0.719	CCAAT/enhancer-binding protein gamma
5	9606.ENSP00000313885	0.684	Transmembrane protein 94
6	9606.ENSP00000278572	0.678	40S ribosomal protein S3
7	9606.ENSP00000450607	0.660	Protein timeless homolog
8	9606.ENSP00000253024	0.618	Transcription intermediary factor 1-beta
9	9606.ENSP00000342626	0.612	Eyes absent homolog 1
10	9606.ENSP00000362136	0.606	Glycoprotein endo-alpha-1,2-mannosidase-like protein
11	9606.ENSP00000388910	0.600	Nuclear factor of activated T-cells, cytoplasmic 4
12	9606.ENSP00000303706	0.561	M-phase inducer phosphatase 1
13	9606.ENSP00000264231	0.541	Popeye domain-containing protein 2
14	9606.ENSP00000419199	0.540	Ankyrin repeat and SOCS box protein 14
15	9606.ENSP00000359942	0.521	Kelch-like protein 31
16	9606.ENSP00000245960	0.519	M-phase inducer phosphatase 2
17	9606.ENSP00000362978	0.511	Eyes absent homolog 3
18	9606.ENSP00000260276	0.505	UPF0686 protein C11orf1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0019222	0.985	regulation of metabolic process
GO:0060255	0.984	regulation of macromolecule metabolic process
GO:0009987	0.981	cellular process
GO:2001020	0.980	regulation of response to DNA damage stimulus
GO:0019219	0.978	regulation of nucleobase-containing compound metabolic process
GO:0048522	0.976	positive regulation of cellular process
GO:0006282	0.974	regulation of DNA repair
GO:2001022	0.973	positive regulation of response to DNA damage stimulus
GO:0051716	0.957	cellular response to stimulus
GO:0051054	0.951	positive regulation of DNA metabolic process
GO:0009314	0.926	response to radiation
GO:0045739	0.887	positive regulation of DNA repair
GO:0048523	0.838	negative regulation of cellular process
GO:1902531	0.838	regulation of intracellular signal transduction
GO:0104004	0.801	cellular response to environmental stimulus
GO:0009411	0.793	response to UV
GO:0033554	0.787	cellular response to stress
GO:0034644	0.783	cellular response to UV
GO:2001021	0.763	negative regulation of response to DNA damage stimulus
GO:2001242	0.762	regulation of intrinsic apoptotic signaling pathway
GO:0023057	0.745	negative regulation of signaling
GO:0010648	0.745	negative regulation of cell communication
GO:1902229	0.695	regulation of intrinsic apoptotic signaling pathway in response to DNA damage
GO:2001234	0.636	negative regulation of apoptotic signaling pathway
GO:2001243	0.600	negative regulation of intrinsic apoptotic signaling pathway
GO:0042221	0.334	response to chemical
GO:0070887	0.316	cellular response to chemical stimulus
GO:0010033	0.313	response to organic substance

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043231	0.998	intracellular membrane-bounded organelle
GO:0005737	0.996	cytoplasm
GO:0016020	0.995	membrane
GO:0012505	0.905	endomembrane system
GO:0071944	0.869	cell periphery
GO:0005886	0.842	plasma membrane
GO:0005783	0.795	endoplasmic reticulum
GO:0005634	0.730	nucleus
GO:0070013	0.519	intracellular organelle lumen
GO:0031981	0.467	nuclear lumen
GO:0005789	0.397	endoplasmic reticulum membrane
GO:0005654	0.391	nucleoplasm
GO:0032991	0.346	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]