StarFunc result for job id Q9NX62

User Input

>input (359 residues)
MAPMGIRLSPLGVAVFCLLGLGVLYHLYSGFLAGRFSLFGLGGEPGGGAAGPAAAADGGT
VDLREMLAVSVLAAVRGGDEVRRVRESNVLHEKSKGKTREGAEDKMTSGDVLSNRKMFYL
LKTAFPSVQINTEEHVDAADQEVILWDHKIPEDILKEVTTPKEVPAESVTVWIDPLDATQ
EYTEDLRKYVTTMVCVAVNGKPMLGVIHKPFSEYTAWAMVDGGSNVKARSSYNEKTPRIV
VSRSHSGMVKQVALQTFGNQTTIIPAGGAGYKVLALLDVPDKSQEKADLYIHVTYIKKWD
ICAGNAILKALGGHMTTLSGEEISYTGSDGIEGGLLASIRMNHQALVRKLPDLEKTGHK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A024R7W0	0.873	0.873	1.211E-72	359	1.000	1.000	A0A024R7W0.pdb.gz
2	AFDB:Q9VYF2	0.728	0.736	2.017E-34	355	0.398	0.403	Q9VYF2.pdb.gz	IMPA3_DROME Putative inositol monophosphatase 3 OS=Drosophila melanogaster OX=7227 GN=CG15743 PE=2 SV=1
3	AFDB:Q23493	0.693	0.775	2.122E-21	319	0.237	0.266	Q23493.pdb.gz	Q23493_CAEEL 3'(2'),5'-bisphosphate nucleotidase 1 OS=Caenorhabditis elegans OX=6239 GN=bpnt-1 PE=1 SV=1
4	PDB:2wefA	0.684	0.804	3.345E-21	303	0.242	0.287	2wefA.pdb.gz	Human 3'(2'), 5'-Bisphosphate Nucleotidase 1 (Bpnt1) in Complex with AMP, Po4 and Magnesium
5	AFDB:O95861	0.695	0.804	6.126E-21	308	0.242	0.282	O95861.pdb.gz	BPNT1_HUMAN 3'(2'),5'-bisphosphate nucleotidase 1 OS=Homo sapiens OX=9606 GN=BPNT1 PE=1 SV=1
6	PDB:6ib8B	0.595	0.776	8.920E-17	270	0.136	0.181	6ib8B.pdb.gz	Structural basis for the function of SuhB as a transcription factor in ribosomal RNA synthesis.
7	AFDB:P0ADG4	0.599	0.791	1.082E-16	267	0.136	0.184	P0ADG4.pdb.gz	SUHB_ECOLI Nus factor SuhB OS=Escherichia coli (strain K12) OX=83333 GN=suhB PE=1 SV=1
8	AFDB:Q57YS3	0.626	0.581	1.634E-16	390	0.240	0.221	Q57YS3.pdb.gz	Q57YS3_TRYB2 Inositol polyphosphate 1-phosphatase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.10K10.600 PE=3 SV=1
9	AFDB:P22255	0.560	0.800	1.733E-16	246	0.167	0.244	P22255.pdb.gz	CYSQ_ECOLI 3'(2'),5'-bisphosphate nucleotidase CysQ OS=Escherichia coli (strain K12) OX=83333 GN=cysQ PE=1 SV=2
10	AFDB:P54927	0.569	0.756	1.828E-15	265	0.162	0.219	P54927.pdb.gz	IMP2_SOLLC Inositol monophosphatase 2 OS=Solanum lycopersicum OX=4081 GN=IMP2 PE=1 SV=1
11	AFDB:P54928	0.591	0.778	2.761E-15	268	0.150	0.201	P54928.pdb.gz	IMP3_SOLLC Inositol monophosphatase 3 OS=Solanum lycopersicum OX=4081 GN=IMP3 PE=1 SV=1
12	AFDB:P29218	0.582	0.741	3.295E-15	277	0.153	0.199	P29218.pdb.gz	IMPA1_HUMAN Inositol monophosphatase 1 OS=Homo sapiens OX=9606 GN=IMPA1 PE=1 SV=1
13	PDB:2bjiA	0.568	0.730	1.500E-14	274	0.148	0.193	2bjiA.pdb.gz	High-resolution structure of myo-inositol monophosphatase, the putative target of lithium therapy.
14	PDB:6giuA	0.578	0.740	2.136E-14	275	0.153	0.200	6giuA.pdb.gz	Co-crystallization of human inositol monophosphatase with the lithium mimetic L-690,330.
15	PDB:4as5A	0.576	0.739	3.630E-14	274	0.131	0.172	4as5A.pdb.gz	Cloning, Expression, Purification, Crystallization and X-Ray Analysis of Inositol Monophosphatase from Mus Musculus and Homo Sapiens.
16	PDB:1k9yA	0.591	0.599	3.404E-13	354	0.173	0.175	1k9yA.pdb.gz	Structural enzymology of Li(+)-sensitive/Mg(2+)-dependent phosphatases.
17	PDB:2cziA	0.535	0.723	5.454E-13	259	0.134	0.185	2cziA.pdb.gz	Crystal structure of human myo-inositol monophosphatase 2, the product of the putative susceptibility gene for bipolar disorder, schizophrenia, and febrile seizures
18	PDB:5djfA	0.561	0.746	1.400E-12	266	0.162	0.218	5djfA.pdb.gz
19	PDB:7vceB	0.531	0.745	2.114E-12	249	0.131	0.189	7vceB.pdb.gz
20	PDB:1inpA	0.589	0.535	1.392E-11	400	0.226	0.203	1inpA.pdb.gz	Crystal structure of inositol polyphosphate 1-phosphatase at 2.3-A resolution.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q80V26	0.0	677	356	0.911	0.919	IMPA3_MOUSE Golgi-resident adenosine 3',5'-bisphosphate 3'-phosphatase OS=Mus musculus OX=10090 GN=Bpnt2 PE=1 SV=1
2	Q9NX62	0.0	737	359	1.000	1.000	IMPA3_HUMAN Golgi-resident adenosine 3',5'-bisphosphate 3'-phosphatase OS=Homo sapiens OX=9606 GN=BPNT2 PE=1 SV=1
3	Q9VYF2	3.01e-68	220	355	0.396	0.400	IMPA3_DROME Putative inositol monophosphatase 3 OS=Drosophila melanogaster OX=7227 GN=CG15743 PE=2 SV=1
4	Q9Z0S1	5.83e-24	102	308	0.220	0.256	BPNT1_MOUSE 3'(2'),5'-bisphosphate nucleotidase 1 OS=Mus musculus OX=10090 GN=Bpnt1 PE=1 SV=2
5	O95861	6.64e-24	102	308	0.265	0.308	BPNT1_HUMAN 3'(2'),5'-bisphosphate nucleotidase 1 OS=Homo sapiens OX=9606 GN=BPNT1 PE=1 SV=1
6	Q9Z1N4	6.83e-23	99.4	308	0.214	0.250	BPNT1_RAT 3'(2'),5'-bisphosphate nucleotidase 1 OS=Rattus norvegicus OX=10116 GN=Bpnt1 PE=1 SV=1
7	Q23493	1.49e-19	90.1	319	0.226	0.254	Q23493_CAEEL 3'(2'),5'-bisphosphate nucleotidase 1 OS=Caenorhabditis elegans OX=6239 GN=bpnt-1 PE=1 SV=1
8	P49441	7.76e-10	62.0	399	0.192	0.173	INPP_HUMAN Inositol polyphosphate 1-phosphatase OS=Homo sapiens OX=9606 GN=INPP1 PE=1 SV=1
9	P21327	1.67e-09	61.2	400	0.153	0.138	INPP_BOVIN Inositol polyphosphate 1-phosphatase OS=Bos taurus OX=9913 GN=INPP1 PE=1 SV=2
10	Q57YS3	9.09e-09	58.9	390	0.223	0.205	Q57YS3_TRYB2 Inositol polyphosphate 1-phosphatase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.10K10.600 PE=3 SV=1
11	P54927	1.44e-07	54.3	265	0.178	0.242	IMP2_SOLLC Inositol monophosphatase 2 OS=Solanum lycopersicum OX=4081 GN=IMP2 PE=1 SV=1
12	O76455	2.95e-06	50.8	375	0.142	0.136	O76455_DROME Inositol polyphosphate 1-phosphatase OS=Drosophila melanogaster OX=7227 GN=Ipp PE=2 SV=1
13	Q9VFP6	3.50e-06	50.8	375	0.142	0.136	Q9VFP6_DROME Inositol polyphosphate 1-phosphatase OS=Drosophila melanogaster OX=7227 GN=Ipp PE=1 SV=1
14	P54928	5.46e-06	49.7	268	0.192	0.257	IMP3_SOLLC Inositol monophosphatase 3 OS=Solanum lycopersicum OX=4081 GN=IMP3 PE=1 SV=1
15	P54926	3.78e-05	47.0	273	0.201	0.264	IMP1_SOLLC Inositol monophosphatase 1 OS=Solanum lycopersicum OX=4081 GN=IMP1 PE=1 SV=1
16	P22255	3.84e-04	43.9	246	0.142	0.207	CYSQ_ECOLI 3'(2'),5'-bisphosphate nucleotidase CysQ OS=Escherichia coli (strain K12) OX=83333 GN=cysQ PE=1 SV=2
17	P9WKJ1	0.003	41.2	267	0.128	0.172	CYSQ_MYCTU 3'-phosphoadenosine 5'-phosphate phosphatase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=cysQ PE=1 SV=1
18	Q9M8S8	0.016	38.9	271	0.139	0.185	VTC4_ARATH Inositol-phosphate phosphatase OS=Arabidopsis thaliana OX=3702 GN=VTC4 PE=1 SV=1
19	P0ADG4	0.017	38.9	267	0.150	0.202	SUHB_ECOLI Nus factor SuhB OS=Escherichia coli (strain K12) OX=83333 GN=suhB PE=1 SV=1
20	Q8NS80	0.021	38.5	260	0.061	0.085	HISN_CORGL Histidinol-phosphatase OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / BCRC 11384 / JCM 1318 / LMG 3730 / NCIMB 10025) OX=196627 GN=hisN PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00459 Inositol_P	2.1e-35	134.2	Inositol monophosphatase family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000262644

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000269159	0.961	Inositol monophosphatase 2
2	9606.ENSP00000408526	0.958	Inositol monophosphatase 1
3	9606.ENSP00000406157	0.953	Bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthase 2
4	9606.ENSP00000265174	0.945	Bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthase 1
5	9606.ENSP00000376142	0.926	Inositol polyphosphate-1-phosphatase
6	9606.ENSP00000219789	0.913	CDP-diacylglycerol--inositol 3-phosphatidyltransferase
7	9606.ENSP00000425487	0.909	Type II inositol 3,4-bisphosphate 4-phosphatase
8	9606.ENSP00000359423	0.905	Myotubularin
9	9606.ENSP00000074304	0.904	Type I inositol 3,4-bisphosphate 4-phosphatase
10	9606.ENSP00000446828	0.855	3'(2'),5'-bisphosphate nucleotidase 1
11	9606.ENSP00000307674	0.775	Soluble calcium-activated nucleotidase 1
12	9606.ENSP00000260402	0.703	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-2
13	9606.ENSP00000430344	0.695	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-1
14	9606.ENSP00000261381	0.692	Xylosyltransferase 1
15	9606.ENSP00000244007	0.667	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-1
16	9606.ENSP00000363590	0.661	Chondroitin sulfate N-acetylgalactosaminyltransferase 2
17	9606.ENSP00000338185	0.657	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-1
18	9606.ENSP00000367762	0.657	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-4
19	9606.ENSP00000443631	0.657	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-3
20	9606.ENSP00000482457	0.657	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008252	0.999	nucleotidase activity
GO:0052745	0.960	inositol phosphate phosphatase activity
GO:0005488	0.951	binding
GO:0005515	0.864	protein binding
GO:0008934	0.433	inositol monophosphate 1-phosphatase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.995	organic substance metabolic process
GO:0044238	0.993	primary metabolic process
GO:0044237	0.993	cellular metabolic process
GO:0006807	0.971	nitrogen compound metabolic process
GO:1901564	0.964	organonitrogen compound metabolic process
GO:0032501	0.939	multicellular organismal process
GO:0006790	0.935	sulfur compound metabolic process
GO:0048856	0.928	anatomical structure development
GO:1901135	0.907	carbohydrate derivative metabolic process
GO:0007275	0.861	multicellular organism development
GO:0043170	0.858	macromolecule metabolic process
GO:0048513	0.856	animal organ development
GO:0048731	0.822	system development
GO:0030203	0.467	glycosaminoglycan metabolic process
GO:0006793	0.445	phosphorus metabolic process
GO:0065007	0.433	biological regulation
GO:0009100	0.426	glycoprotein metabolic process
GO:0006796	0.423	phosphate-containing compound metabolic process
GO:1903510	0.357	mucopolysaccharide metabolic process
GO:0001501	0.349	skeletal system development
GO:0009790	0.346	embryo development
GO:0050789	0.327	regulation of biological process
GO:0061448	0.324	connective tissue development
GO:0006029	0.318	proteoglycan metabolic process
GO:0009887	0.311	animal organ morphogenesis
GO:0050794	0.305	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005794	1.000	Golgi apparatus
GO:0005829	0.999	cytosol
GO:0070013	0.997	intracellular organelle lumen
GO:0005634	0.991	nucleus
GO:0016020	0.990	membrane
GO:0031981	0.961	nuclear lumen
GO:0005654	0.947	nucleoplasm
GO:0016604	0.738	nuclear body
GO:0031090	0.517	organelle membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:22140	0.999	a nucleoside 5'-phosphate + H2O = a nucleoside + phosphate
RHEA:27670	0.433	1D-myo-inositol 1-phosphate + H2O = myo-inositol + phosphate
EC:3.1.3.25	0.433	inositol-phosphate phosphatase.

[back to server]