StarFunc result for job id Q9NX65

User Input

>input (697 residues)
MMAAVKSTEAHPSSNKDPTQGQKSALQGNSPDSEASRQRFRQFCYQEVTGPHEAFSKLWE
LCCQWLRPKTHSKEEILELLVLEQFLTILPEEIQTWVREQHPENGEEAVALVEDVQRAPG
QQVLDSEKDLKVLMKEMAPLGATRESLRSQWKQEVQPEEPTFKGSQSSHQRPGEQSEAWL
APQAPRNLPQNTGLHDQETGAVVWTAGSQGPAMRDNRAVSLCQQEWMCPGPAQRALYRGA
TQRKDSHVSLATGVPWGYEETKTLLAILSSSQFYGKLQTCQQNSQIYRAMAEGLWEQGFL
RTPEQCRTKFKSLQLSYRKVRRGRVPEPCIFYEEMNALSGSWASAPPMASDAVPGQEGSD
IEAGELNHQNGEPTEVEDGTVDGADRDEKDFRNPGQEVRKLDLPVLFPNRLGFEFKNEIK
KENLKWDDSEEVEINKALQRKSRGVYWHSELQKGLESEPTSRRQCRNSPGESEEKTPSQE
KMSHQSFCARDKACTHILCGKNCSQSVHSPHKPALKLEKVSQCPECGKTFSRSSYLVRHQ
RIHTGEKPHKCSECGKGFSERSNLTAHLRTHTGERPYQCGQCGKSFNQSSSLIVHQRTHT
GEKPYQCIVCGKRFNNSSQFSAHRRIHTGESPYKCAVCGKIFNNSSHFSAHRKTHTGEKP
YRCSHCERGFTKNSALTRHQTVHMKAVLSSQEGRDAL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9NX65	1.000	1.000	0.000	697	1.000	1.000	Q9NX65.pdb.gz	ZSC32_HUMAN Zinc finger and SCAN domain-containing protein 32 OS=Homo sapiens OX=9606 GN=ZSCAN32 PE=1 SV=3
2	AFDB:Q8IWY8	0.258	0.216	5.005E-44	852	0.456	0.373	Q8IWY8.pdb.gz	ZSC29_HUMAN Zinc finger and SCAN domain-containing protein 29 OS=Homo sapiens OX=9606 GN=ZSCAN29 PE=1 SV=2
3	AFDB:P17040	0.246	0.168	9.708E-35	1043	0.413	0.276	P17040.pdb.gz	ZSC20_HUMAN Zinc finger and SCAN domain-containing protein 20 OS=Homo sapiens OX=9606 GN=ZSCAN20 PE=1 SV=3
4	AFDB:Q9P0L1	0.230	0.213	2.181E-32	754	0.293	0.271	Q9P0L1.pdb.gz	ZKSC7_HUMAN Zinc finger protein with KRAB and SCAN domains 7 OS=Homo sapiens OX=9606 GN=ZKSCAN7 PE=1 SV=2
5	AFDB:Q86W11	0.223	0.308	1.554E-30	494	0.278	0.393	Q86W11.pdb.gz	ZSC30_HUMAN Zinc finger and SCAN domain-containing protein 30 OS=Homo sapiens OX=9606 GN=ZSCAN30 PE=1 SV=1
6	AFDB:O14978	0.138	0.140	1.822E-29	683	0.307	0.313	O14978.pdb.gz	ZN263_HUMAN Zinc finger protein 263 OS=Homo sapiens OX=9606 GN=ZNF263 PE=1 SV=2
7	AFDB:Q9BRR0	0.210	0.265	4.875E-29	538	0.288	0.374	Q9BRR0.pdb.gz	ZKSC3_HUMAN Zinc finger protein with KRAB and SCAN domains 3 OS=Homo sapiens OX=9606 GN=ZKSCAN3 PE=1 SV=2
8	AFDB:Q8NF99	0.227	0.292	5.149E-29	534	0.265	0.346	Q8NF99.pdb.gz	ZN397_HUMAN Zinc finger protein 397 OS=Homo sapiens OX=9606 GN=ZNF397 PE=1 SV=2
9	AFDB:Q53GI3	0.172	0.206	5.745E-29	561	0.286	0.355	Q53GI3.pdb.gz	ZN394_HUMAN Zinc finger protein 394 OS=Homo sapiens OX=9606 GN=ZNF394 PE=1 SV=2
10	AFDB:O60304	0.216	0.306	2.135E-28	480	0.278	0.404	O60304.pdb.gz	ZN500_HUMAN Zinc finger protein 500 OS=Homo sapiens OX=9606 GN=ZNF500 PE=1 SV=2
11	PDB:3w5kB	0.073	0.247	1.010E-3	110	0.052	0.327	3w5kB.pdb.gz	Structural basis for the selective nuclear import of the C2H2 zinc-finger protein Snail by importin beta.
12	PDB:5gm6a	0.032	0.104	1.457	123	0.033	0.187	5gm6a.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution
13	PDB:5gmkc	0.043	0.063	1.916	436	0.065	0.103	5gmkc.pdb.gz	Structure of a yeast catalytic step I spliceosome at 3.4 angstrom resolution
14	PDB:7dvqM	0.033	0.107	1.916	191	0.047	0.173	7dvqM.pdb.gz	Structure of the activated human minor spliceosome.
15	PDB:3j6bT	0.047	0.097	3.693	209	0.026	0.086	3j6bT.pdb.gz	Structure of the yeast mitochondrial large ribosomal subunit.
16	PDB:6ke6A8	0.062	0.071	3.693	548	0.026	0.033	6ke6A8.pdb.gz	3.4 angstrom cryo-EM structure of yeast 90S small subunit preribosome
17	PDB:6j6gc	0.044	0.063	3.900	436	0.067	0.108	6j6gc.pdb.gz	Structures of the Catalytically Activated Yeast Spliceosome Reveal the Mechanism of Branching.
18	PDB:7azyH	0.063	0.202	5.127	188	0.033	0.122	7azyH.pdb.gz	Context-specific action of macrolide antibiotics on the eukaryotic ribosome.
19	PDB:7oqyY	0.033	0.146	5.127	92	0.032	0.239	7oqyY.pdb.gz	Structural basis of RNA polymerase inhibition by viral and host factors.
20	PDB:1ykhB	0.056	0.229	5.415	114	0.024	0.149	1ykhB.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9NX65	0.0	1452	697	1.000	1.000	ZSC32_HUMAN Zinc finger and SCAN domain-containing protein 32 OS=Homo sapiens OX=9606 GN=ZSCAN32 PE=1 SV=3
2	Q8IWY8	2.42e-124	392	852	0.323	0.264	ZSC29_HUMAN Zinc finger and SCAN domain-containing protein 29 OS=Homo sapiens OX=9606 GN=ZSCAN29 PE=1 SV=2
3	O14978	7.11e-93	305	683	0.344	0.351	ZN263_HUMAN Zinc finger protein 263 OS=Homo sapiens OX=9606 GN=ZNF263 PE=1 SV=2
4	Q8CF60	1.95e-87	290	680	0.353	0.362	ZN263_MOUSE Zinc finger protein 263 OS=Mus musculus OX=10090 GN=Znf263 PE=1 SV=1
5	P17040	1.35e-80	279	1043	0.275	0.184	ZSC20_HUMAN Zinc finger and SCAN domain-containing protein 20 OS=Homo sapiens OX=9606 GN=ZSCAN20 PE=1 SV=3
6	Q6ZN57	3.60e-63	219	461	0.148	0.223	ZFP2_HUMAN Zinc finger protein ZFP2 OS=Homo sapiens OX=9606 GN=ZFP2 PE=1 SV=1
7	Q9NQZ8	4.31e-63	219	489	0.159	0.227	ZNF71_HUMAN Endothelial zinc finger protein induced by tumor necrosis factor alpha OS=Homo sapiens OX=9606 GN=ZNF71 PE=1 SV=1
8	P17029	4.55e-63	221	563	0.138	0.171	ZKSC1_HUMAN Zinc finger protein with KRAB and SCAN domains 1 OS=Homo sapiens OX=9606 GN=ZKSCAN1 PE=1 SV=3
9	Q9C0F3	1.88e-62	218	470	0.149	0.221	ZN436_HUMAN Zinc finger protein 436 OS=Homo sapiens OX=9606 GN=ZNF436 PE=1 SV=2
10	P10073	4.96e-62	217	491	0.145	0.206	ZSC22_HUMAN Zinc finger and SCAN domain-containing protein 22 OS=Homo sapiens OX=9606 GN=ZSCAN22 PE=1 SV=2
11	P17036	4.99e-62	216	446	0.152	0.238	ZNF3_HUMAN Zinc finger protein 3 OS=Homo sapiens OX=9606 GN=ZNF3 PE=1 SV=3
12	Q15937	5.37e-62	217	498	0.152	0.213	ZNF79_HUMAN Zinc finger protein 79 OS=Homo sapiens OX=9606 GN=ZNF79 PE=1 SV=2
13	Q86W11	7.15e-62	216	494	0.152	0.215	ZSC30_HUMAN Zinc finger and SCAN domain-containing protein 30 OS=Homo sapiens OX=9606 GN=ZSCAN30 PE=1 SV=1
14	Q86U76	9.94e-62	214	410	0.152	0.259	Q86U76_HUMAN Zinc finger protein 3 OS=Homo sapiens OX=9606 GN=ZNF3 PE=1 SV=1
15	Q96RE9	2.26e-61	218	604	0.149	0.172	ZN300_HUMAN Zinc finger protein 300 OS=Homo sapiens OX=9606 GN=ZNF300 PE=1 SV=1
16	A0A0A0MS50	2.33e-61	218	604	0.149	0.172	A0A0A0MS50_HUMAN Zinc finger protein 300 OS=Homo sapiens OX=9606 GN=ZNF300 PE=1 SV=1
17	Q9HBT8	3.36e-61	215	521	0.148	0.198	Z286A_HUMAN Zinc finger protein 286A OS=Homo sapiens OX=9606 GN=ZNF286A PE=1 SV=1
18	Q8N3J9	4.16e-61	207	261	0.142	0.379	ZN664_HUMAN Zinc finger protein 664 OS=Homo sapiens OX=9606 GN=ZNF664 PE=1 SV=1
19	P52742	5.89e-61	218	658	0.149	0.158	ZN135_HUMAN Zinc finger protein 135 OS=Homo sapiens OX=9606 GN=ZNF135 PE=1 SV=3
20	Q86UD4	1.00e-60	214	541	0.139	0.179	ZN329_HUMAN Zinc finger protein 329 OS=Homo sapiens OX=9606 GN=ZNF329 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01722 BolA	1.1	21.0	BolA-like protein
2	PF12833 HTH_18	82	14.9	Helix-turn-helix domain
3	PF01352 KRAB	1.6	19.7	KRAB box
4	PF00249 Myb_DNA-binding	3.1e+02	13.0	Myb-like DNA-binding domain
5	PF13837 Myb_DNA-bind_4	6.3e-13	60.2	Myb/SANT-like DNA-binding domain
6	PF13921 Myb_DNA-bind_6	1.9e+02	13.7	Myb-like DNA-binding domain
7	PF02023 SCAN	7e-41	149.3	SCAN domain
8	PF01286 XPA_N	6.8e+02	11.7	XPA protein N-terminal
9	PF00096 zf-C2H2	9.9e-30	112.5	Zinc finger, C2H2 type
10	PF16622 zf-C2H2_11	1.2	20.3	zinc-finger C2H2-type
11	PF13894 zf-C2H2_4	4.6e-17	72.2	C2H2-type zinc finger
12	PF13912 zf-C2H2_6	1.3	20.4	C2H2-type zinc finger
13	PF12171 zf-C2H2_jaz	3.7e-12	57.4	Zinc-finger double-stranded RNA-binding
14	PF13913 zf-C2HC_2	10	17.4	zinc-finger of a C2HC-type
15	PF05605 zf-Di19	33	16.2	Drought induced 19 protein (Di19), zinc-binding
16	PF13465 zf-H2C2_2	1.2e-38	141.1	Zinc-finger double domain
17	PF08790 zf-LYAR	1.3e+02	13.8	LYAR-type C2HC zinc finger
18	PF12874 zf-met	3	19.6	Zinc-finger of C2H2 type
19	PF16744 zf-RING_15	9.5e+02	11.3	KIAA1045 RING finger
20	PF18439 zf_UBZ	54	14.9	Ubiquitin-Binding Zinc Finger

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000380057

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000268655	0.892	Zinc finger protein 174
2	9606.ENSP00000292450	0.878	Zinc finger and SCAN domain-containing protein 21
3	9606.ENSP00000323148	0.877	Zinc finger protein with KRAB and SCAN domains 1
4	9606.ENSP00000259883	0.874	PiggyBac transposable element-derived protein 1
5	9606.ENSP00000366509	0.873	Zinc finger protein with KRAB and SCAN domains 4
6	9606.ENSP00000363103	0.872	SCAN domain-containing protein 1
7	9606.ENSP00000472802	0.872	Zinc finger protein 446
8	9606.ENSP00000261332	0.871	Zinc finger protein 24
9	9606.ENSP00000332433	0.871	Zinc finger and SCAN domain-containing protein 22
10	9606.ENSP00000366527	0.869	Zinc finger and SCAN domain-containing protein 16
11	9606.ENSP00000338860	0.867	Zinc finger protein 444
12	9606.ENSP00000289788	0.841	Zinc finger and SCAN domain-containing protein 23
13	9606.ENSP00000366465	0.830	Zinc finger protein with KRAB and SCAN domains 3
14	9606.ENSP00000395259	0.828	SCAN domain-containing protein 3
15	9606.ENSP00000380087	0.821	Zinc finger protein 213
16	9606.ENSP00000392371	0.801	Zinc finger and SCAN domain-containing protein 30
17	9606.ENSP00000331577	0.790	Zinc finger protein 397
18	9606.ENSP00000379370	0.787	Zinc finger protein 197
19	9606.ENSP00000337363	0.779	Zinc finger protein 394
20	9606.ENSP00000250076	0.778	Zinc finger protein 232

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0042802	0.997	identical protein binding
GO:1901363	0.886	heterocyclic compound binding
GO:0097159	0.886	organic cyclic compound binding
GO:0003677	0.881	DNA binding
GO:0043565	0.854	sequence-specific DNA binding
GO:0003690	0.849	double-stranded DNA binding
GO:1990837	0.844	sequence-specific double-stranded DNA binding
GO:0003700	0.700	DNA-binding transcription factor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0006355	0.998	regulation of DNA-templated transcription
GO:1903507	0.977	negative regulation of nucleic acid-templated transcription
GO:0045892	0.973	negative regulation of DNA-templated transcription
GO:0006357	0.685	regulation of transcription by RNA polymerase II
GO:0048518	0.594	positive regulation of biological process
GO:0048522	0.561	positive regulation of cellular process
GO:0009893	0.470	positive regulation of metabolic process
GO:0010604	0.449	positive regulation of macromolecule metabolic process
GO:0045935	0.419	positive regulation of nucleobase-containing compound metabolic process
GO:0045893	0.410	positive regulation of DNA-templated transcription
GO:0009987	0.369	cellular process
GO:0000122	0.323	negative regulation of transcription by RNA polymerase II

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.995	nucleoplasm
GO:0005737	0.487	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]