StarFunc result for job id Q9NX70

User Input

>input (200 residues)
MAASQQQASAASSAAGVSGPSSAGGPGPQQQPQPPAQLVGPAQSGLLQQQQQDFDPVQRY
KMLIPQLKESLQTLMKVAAQNLIQNTNIDNGQKSSDGPIQRFDKCLEEFYALCDQLELCL
RLAHECLSQSCDSAKHSPTLVPTATKPDAVQPDSLPYPQYLAVIKAQISCAKDIHTALLD
CANKVTGKTPAPPAGPGGTL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:B4DUA7	0.526	0.481	5.731E-26	221	0.965	0.873	B4DUA7.pdb.gz	B4DUA7_HUMAN Mediator of RNA polymerase II transcription subunit 29 OS=Homo sapiens OX=9606 GN=MED29 PE=1 SV=1
2	AFDB:Q8JHI6	0.501	0.554	5.818E-14	179	0.525	0.587	Q8JHI6.pdb.gz	MED29_DANRE Mediator of RNA polymerase II transcription subunit 29 OS=Danio rerio OX=7955 GN=med29 PE=2 SV=1
3	PDB:7emf2	0.422	0.705	4.215E-13	115	0.565	0.983	7emf2.pdb.gz	Structures of the human Mediator and Mediator-bound preinitiation complex.
4	AFDB:Q7KBL8	0.446	0.468	9.869E-9	188	0.310	0.330	Q7KBL8.pdb.gz	MED29_DROME Mediator of RNA polymerase II transcription subunit 29 OS=Drosophila melanogaster OX=7227 GN=ix PE=1 SV=1
5	AFDB:Q54I36	0.185	0.045	2.078E-2	1338	0.150	0.022	Q54I36.pdb.gz	PYK3_DICDI Dual specificity protein kinase pyk3 OS=Dictyostelium discoideum OX=44689 GN=pyk3 PE=1 SV=1
6	AFDB:Q9P7X2	0.188	0.108	3.398E-2	533	0.085	0.032	Q9P7X2.pdb.gz	ELL1_SCHPO RNA polymerase II elongation factor ell1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ell1 PE=1 SV=1
7	AFDB:G3V9M3	0.264	0.085	4.344E-2	921	0.155	0.034	G3V9M3.pdb.gz	G3V9M3_RAT WD repeat domain 47 OS=Rattus norvegicus OX=10116 GN=Wdr47 PE=1 SV=1
8	AFDB:F8WJN3	0.185	0.085	7.102E-2	478	0.110	0.046	F8WJN3.pdb.gz	F8WJN3_HUMAN Cleavage and polyadenylation specificity factor subunit 6 OS=Homo sapiens OX=9606 GN=CPSF6 PE=1 SV=1
9	AFDB:Q5T1N1	0.188	0.069	7.102E-2	836	0.155	0.037	Q5T1N1.pdb.gz	AKND1_HUMAN Protein AKNAD1 OS=Homo sapiens OX=9606 GN=AKNAD1 PE=1 SV=3
10	AFDB:O76064	0.339	0.156	9.655E-2	485	0.150	0.062	O76064.pdb.gz	RNF8_HUMAN E3 ubiquitin-protein ligase RNF8 OS=Homo sapiens OX=9606 GN=RNF8 PE=1 SV=1
11	AFDB:Q9XUS2	0.339	0.171	1.161E-1	441	0.185	0.084	Q9XUS2.pdb.gz	MED29_CAEEL Mediator of RNA polymerase II transcription subunit 29 OS=Caenorhabditis elegans OX=6239 GN=mdt-29 PE=1 SV=1
12	PDB:4gwpA	0.224	0.332	1.252E-1	112	0.105	0.188	4gwpA.pdb.gz
13	PDB:4h63H	0.146	0.167	2.461E-1	174	0.115	0.132	4h63H.pdb.gz
14	PDB:5u1dA	0.293	0.122	5.145E-1	561	0.115	0.041	5u1dA.pdb.gz
15	PDB:7lbmn	0.188	0.146	5.817E-1	283	0.105	0.074	7lbmn.pdb.gz	Structure of the human Mediator-bound transcription preinitiation complex.
16	PDB:4q4aA	0.189	0.086	6.995E-1	572	0.055	0.019	4q4aA.pdb.gz	Structural basis for allosteric cross-talk between the asymmetric nucleotide binding sites of a heterodimeric ABC exporter.
17	PDB:1h7cA	0.183	0.325	7.438E-1	103	0.055	0.107	1h7cA.pdb.gz
18	PDB:7nvrk	0.170	0.225	7.909E-1	133	0.095	0.143	7nvrk.pdb.gz	Structures of mammalian RNA polymerase II pre-initiation complexes.
19	PDB:7vvuV	0.207	0.296	9.510E-1	113	0.060	0.106	7vvuV.pdb.gz	Structure of the NuA4 acetyltransferase complex bound to the nucleosome.
20	PDB:3hajA	0.182	0.130	1.075	286	0.040	0.028	3hajA.pdb.gz	Molecular mechanism of membrane constriction and tubulation mediated by the F-BAR protein Pacsin/Syndapin.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B4DUA7	7.94e-144	401	221	1.000	0.905	B4DUA7_HUMAN Mediator of RNA polymerase II transcription subunit 29 OS=Homo sapiens OX=9606 GN=MED29 PE=1 SV=1
2	Q9NX70	1.54e-143	399	200	1.000	1.000	MED29_HUMAN Mediator of RNA polymerase II transcription subunit 29 OS=Homo sapiens OX=9606 GN=MED29 PE=1 SV=1
3	Q9DB91	1.22e-107	308	199	0.780	0.784	MED29_MOUSE Mediator of RNA polymerase II transcription subunit 29 OS=Mus musculus OX=10090 GN=Med29 PE=1 SV=1
4	Q8JHI6	1.49e-69	211	179	0.490	0.547	MED29_DANRE Mediator of RNA polymerase II transcription subunit 29 OS=Danio rerio OX=7955 GN=med29 PE=2 SV=1
5	Q7KBL8	8.68e-20	84.7	188	0.245	0.261	MED29_DROME Mediator of RNA polymerase II transcription subunit 29 OS=Drosophila melanogaster OX=7227 GN=ix PE=1 SV=1
6	Q9XUS2	0.32	33.9	441	0.105	0.048	MED29_CAEEL Mediator of RNA polymerase II transcription subunit 29 OS=Caenorhabditis elegans OX=6239 GN=mdt-29 PE=1 SV=1
7	P13526	0.79	32.7	610	0.055	0.018	ARLC_MAIZE Anthocyanin regulatory Lc protein OS=Zea mays OX=4577 GN=LC PE=1 SV=1
8	Q8VHP6	0.92	32.7	859	0.090	0.021	CDHR1_MOUSE Cadherin-related family member 1 OS=Mus musculus OX=10090 GN=Cdhr1 PE=1 SV=1
9	Q388Z4	1.0	32.7	1132	0.115	0.020	Q388Z4_TRYB2 Kinesin, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.389.1210 PE=3 SV=1
10	A1L3A9	2.1	31.6	1232	0.075	0.012	A1L3A9_HUMAN TBC1 domain family, member 9B (With GRAM domain) OS=Homo sapiens OX=9606 GN=TBC1D9B PE=1 SV=1
11	Q400N1	2.3	31.6	1109	0.110	0.020	Q400N1_DROME FI22203p1 OS=Drosophila melanogaster OX=7227 GN=Plp PE=1 SV=1
12	Q8T9E5	2.5	31.2	1109	0.110	0.020	Q8T9E5_DROME SD04227p OS=Drosophila melanogaster OX=7227 GN=Plp PE=2 SV=1
13	A0A1S3C4H6	2.6	31.2	1888	0.210	0.022	IF4G_CUCME Eukaryotic translation initiation factor 4G OS=Cucumis melo OX=3656 GN=eIF4G PE=1 SV=1
14	Q0J995	3.4	30.8	424	0.055	0.026	RLI1_ORYSJ Myb family transcription factor RLI1 OS=Oryza sativa subsp. japonica OX=39947 GN=RLI1 PE=1 SV=1
15	P79023	3.8	30.4	370	0.120	0.065	AROG_CANAL Phospho-2-dehydro-3-deoxyheptonate aldolase, tyrosine-inhibited OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ARO4 PE=3 SV=1
16	Q9H7C4	4.1	30.4	482	0.105	0.044	SYNCI_HUMAN Syncoilin OS=Homo sapiens OX=9606 GN=SYNC PE=1 SV=3
17	M9PCJ5	4.3	30.8	2891	0.110	0.008	M9PCJ5_DROME Pericentrin-like protein, isoform G OS=Drosophila melanogaster OX=7227 GN=Plp PE=1 SV=1
18	M9PFJ2	4.3	30.8	2831	0.110	0.008	M9PFJ2_DROME Pericentrin-like protein, isoform K OS=Drosophila melanogaster OX=7227 GN=Plp PE=1 SV=1
19	M9ND93	4.4	30.8	2730	0.110	0.008	M9ND93_DROME Pericentrin-like protein, isoform P OS=Drosophila melanogaster OX=7227 GN=Plp PE=1 SV=1
20	M9NFV3	4.4	30.8	2767	0.110	0.008	M9NFV3_DROME Pericentrin-like protein, isoform D OS=Drosophila melanogaster OX=7227 GN=Plp PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF11568 Med29	7.5e-50	180.2	Mediator complex subunit 29

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 60711.ENSCSAP00000000228

Rank	PPI partner	STRING score	Description
1	60711.ENSCSAP00000017001	0.971	Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors
2	60711.ENSCSAP00000007503	0.963	Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors
3	60711.ENSCSAP00000002302	0.958	Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors
4	60711.ENSCSAP00000016831	0.956	Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors
5	60711.ENSCSAP00000019216	0.955	Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery
6	60711.ENSCSAP00000009255	0.953	Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors
7	60711.ENSCSAP00000011010	0.953	Mediator complex subunit 27
8	60711.ENSCSAP00000008762	0.951	Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors
9	60711.ENSCSAP00000009154	0.950	Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors
10	60711.ENSCSAP00000010129	0.945	Mediator complex subunit 14
11	60711.ENSCSAP00000008553	0.943	Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors
12	60711.ENSCSAP00000014624	0.943	Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors
13	60711.ENSCSAP00000015279	0.940	Mediator complex subunit 24
14	60711.ENSCSAP00000013766	0.938	Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors
15	60711.ENSCSAP00000003920	0.937	Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors
16	60711.ENSCSAP00000013376	0.932	Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors
17	60711.ENSCSAP00000015361	0.931	Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors
18	60711.ENSCSAP00000002210	0.924	Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors
19	60711.ENSCSAP00000014007	0.919	Cyclin-dependent kinase 8
20	60711.ENSCSAP00000007638	0.910	Mediator complex subunit 12

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0044238	0.977	primary metabolic process
GO:0071704	0.966	organic substance metabolic process
GO:0032501	0.929	multicellular organismal process
GO:0050789	0.901	regulation of biological process
GO:0050794	0.880	regulation of cellular process
GO:0019222	0.869	regulation of metabolic process
GO:0006807	0.854	nitrogen compound metabolic process
GO:0043170	0.822	macromolecule metabolic process
GO:0080090	0.816	regulation of primary metabolic process
GO:0060255	0.800	regulation of macromolecule metabolic process
GO:0009889	0.779	regulation of biosynthetic process
GO:0010468	0.771	regulation of gene expression
GO:0010556	0.769	regulation of macromolecule biosynthetic process
GO:0031326	0.769	regulation of cellular biosynthetic process
GO:0051252	0.769	regulation of RNA metabolic process
GO:0009987	0.760	cellular process
GO:0006355	0.718	regulation of DNA-templated transcription
GO:0006357	0.608	regulation of transcription by RNA polymerase II
GO:0048518	0.517	positive regulation of biological process
GO:0010604	0.514	positive regulation of macromolecule metabolic process
GO:0031325	0.510	positive regulation of cellular metabolic process
GO:0051173	0.505	positive regulation of nitrogen compound metabolic process
GO:0032502	0.472	developmental process
GO:0045935	0.439	positive regulation of nucleobase-containing compound metabolic process
GO:0051254	0.404	positive regulation of RNA metabolic process
GO:0031328	0.373	positive regulation of cellular biosynthetic process
GO:0010557	0.371	positive regulation of macromolecule biosynthetic process
GO:0045944	0.362	positive regulation of transcription by RNA polymerase II
GO:0035019	0.357	somatic stem cell population maintenance
GO:0048856	0.316	anatomical structure development
GO:0019538	0.302	protein metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0032991	0.996	protein-containing complex
GO:0090575	0.971	RNA polymerase II transcription regulator complex
GO:0070847	0.938	core mediator complex
GO:0016592	0.902	mediator complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]