StarFunc result for job id Q9NX94

User Input

>input (342 residues)
MPFLLGLRQDKEACVGTNNQSYICDTGHCCGQSQCCNYYYELWWFWLVWTIIIILSCCCV
CHHRRAKHRLQAQQRQHEINLIAYREAHNYSALPFYFRFLPNYLLPPYEEVVNRPPTPPP
PYSAFQLQQQQLLPPQCGPAGGSPPGIDPTRGSQGAQSSPLSEPSRSSTRPPSIADPDPS
DLPVDRAATKAPGMEPSGSVAGLGELDPGAFLDKDAECREELLKDDSSEHGAPDSKEKTP
GRHRRFTGDSGIEVCVCNRGHHDDDLKEFNTLIDDALDGPLDFCDSCHVRPPGDEEEGLC
QSSEEQAREPGHPHLPRPPACLLLNTINEQDSPNSQSSSSPS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9NX94	0.999	0.999	2.278E-52	342	1.000	1.000	Q9NX94.pdb.gz	WBP1L_HUMAN WW domain binding protein 1-like OS=Homo sapiens OX=9606 GN=WBP1L PE=1 SV=2
2	AFDB:Q8BGW2	0.297	0.293	2.581E-41	348	0.880	0.865	Q8BGW2.pdb.gz	WBP1L_MOUSE WW domain binding protein 1-like OS=Mus musculus OX=10090 GN=Wbp1l PE=2 SV=1
3	AFDB:A0A0B4K6W9	0.131	0.056	2.173E-1	898	0.161	0.061	A0A0B4K6W9.pdb.gz	A0A0B4K6W9_DROME Hephaestus, isoform Y OS=Drosophila melanogaster OX=7227 GN=heph PE=1 SV=1
4	AFDB:Q6IE81	0.149	0.065	3.261E-1	842	0.175	0.071	Q6IE81.pdb.gz	JADE1_HUMAN Protein Jade-1 OS=Homo sapiens OX=9606 GN=JADE1 PE=1 SV=1
5	AFDB:A0A1L8I316	0.162	0.162	3.734E-1	341	0.155	0.155	A0A1L8I316.pdb.gz	HWA_XENLA Protein huluwa OS=Xenopus laevis OX=8355 GN=hwa PE=2 SV=1
6	AFDB:Q02040	0.134	0.070	9.003E-1	695	0.117	0.058	Q02040.pdb.gz	AK17A_HUMAN A-kinase anchor protein 17A OS=Homo sapiens OX=9606 GN=AKAP17A PE=1 SV=2
7	AFDB:Q5ZQU2	0.125	0.067	9.634E-1	815	0.167	0.070	Q5ZQU2.pdb.gz	NPAS2_CHICK Neuronal PAS domain-containing protein 2 OS=Gallus gallus OX=9031 GN=NPAS2 PE=1 SV=1
8	AFDB:Q7JWP9	0.137	0.058	1.103	915	0.167	0.062	Q7JWP9.pdb.gz	Q7JWP9_DROME RE09008p OS=Drosophila melanogaster OX=7227 GN=tartan/capricious-like PE=1 SV=1
9	AFDB:A7MCY6	0.152	0.086	1.180	615	0.164	0.091	A7MCY6.pdb.gz	TBKB1_HUMAN TANK-binding kinase 1-binding protein 1 OS=Homo sapiens OX=9606 GN=TBKBP1 PE=1 SV=1
10	AFDB:P43322	0.141	0.080	1.351	662	0.155	0.080	P43322.pdb.gz	NRG1_RAT Pro-neuregulin-1, membrane-bound isoform OS=Rattus norvegicus OX=10116 GN=Nrg1 PE=1 SV=1
11	PDB:4msxA	0.041	0.036	8.028	395	0.009	0.008	4msxA.pdb.gz	The crystal structure of S. cerevisiae Sad1, a catalytically inactive deubiquitinase that is broadly required for pre-mRNA splicing.
12	PDB:5a20A	0.049	0.038	8.590	439	0.012	0.009	5a20A.pdb.gz
13	PDB:5xqmA	0.044	0.141	9.836	90	0.012	0.044	5xqmA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8BGW2	0.0	545	348	0.839	0.825	WBP1L_MOUSE WW domain binding protein 1-like OS=Mus musculus OX=10090 GN=Wbp1l PE=2 SV=1
2	Q9NX94	0.0	701	342	1.000	1.000	WBP1L_HUMAN WW domain binding protein 1-like OS=Homo sapiens OX=9606 GN=WBP1L PE=1 SV=2
3	Q96G27	5.58e-39	141	269	0.205	0.260	WBP1_HUMAN WW domain-binding protein 1 OS=Homo sapiens OX=9606 GN=WBP1 PE=1 SV=1
4	P97764	8.62e-36	133	304	0.196	0.220	WBP1_MOUSE WW domain-binding protein 1 OS=Mus musculus OX=10090 GN=Wbp1 PE=1 SV=2
5	Q9W4M4	0.022	39.3	1357	0.076	0.019	Q9W4M4_DROME Uncharacterized protein OS=Drosophila melanogaster OX=7227 GN=Dmel\CG15570 PE=1 SV=1
6	P0C6T3	0.031	38.1	269	0.038	0.048	PRR7_RAT Proline-rich protein 7 OS=Rattus norvegicus OX=10116 GN=Prr7 PE=1 SV=1
7	Q8TB68	0.034	38.1	274	0.038	0.047	PRR7_HUMAN Proline-rich protein 7 OS=Homo sapiens OX=9606 GN=PRR7 PE=1 SV=1
8	Q3V0I2	0.036	37.7	269	0.038	0.048	PRR7_MOUSE Proline-rich protein 7 OS=Mus musculus OX=10090 GN=Prr7 PE=1 SV=1
9	F1QLG5	1.1	33.9	969	0.114	0.040	ADN1A_DANRE Activity-dependent neuroprotective protein a OS=Danio rerio OX=7955 GN=adnpa PE=1 SV=1
10	Q18100	1.1	33.9	1144	0.056	0.017	Q18100_CAEEL Fibronectin type-III domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=sax-7 PE=1 SV=3
11	Q53U86	1.1	33.9	1147	0.056	0.017	Q53U86_CAEEL Fibronectin type-III domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=sax-7 PE=1 SV=1
12	A0A2R8Q4R6	1.3	33.5	2052	0.120	0.020	A0A2R8Q4R6_DANRE Methylcytosine dioxygenase TET OS=Danio rerio OX=7955 GN=si:ch211-220a11.1 PE=1 SV=1
13	Q4PIU9	1.3	33.5	1328	0.056	0.014	Q4PIU9_CAEEL Neuroglian OS=Caenorhabditis elegans OX=6239 GN=sax-7 PE=1 SV=1
14	Q53U87	1.3	33.5	1331	0.056	0.014	Q53U87_CAEEL Neuroglian OS=Caenorhabditis elegans OX=6239 GN=sax-7 PE=1 SV=1
15	A1Z9J3	1.8	33.1	8805	0.053	0.002	A1Z9J3_DROME Short stop, isoform H OS=Drosophila melanogaster OX=7227 GN=shot PE=1 SV=1
16	Q9EP89	4.1	32.0	551	0.047	0.029	LACTB_MOUSE Serine beta-lactamase-like protein LACTB, mitochondrial OS=Mus musculus OX=10090 GN=Lactb PE=1 SV=1
17	Q7Z5P9	9.9	30.8	8384	0.056	0.002	MUC19_HUMAN Mucin-19 OS=Homo sapiens OX=9606 GN=MUC19 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF11669 WBP-1	1.3e-39	146.5	WW domain-binding protein 1

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 60711.ENSCSAP00000001710

Rank	PPI partner	STRING score	Description
1	60711.ENSCSAP00000016871	0.559	Rearranged L-myc fusion
2	60711.ENSCSAP00000015123	0.558	Colorectal cancer associated 2
3	60711.ENSCSAP00000019210	0.558	annotation not available
4	60711.ENSCSAP00000013393	0.529	Zinc finger protein 292

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.995	regulation of biological process
GO:0050794	0.994	regulation of cellular process
GO:0009987	0.987	cellular process
GO:0048518	0.975	positive regulation of biological process
GO:0080090	0.969	regulation of primary metabolic process
GO:0051171	0.958	regulation of nitrogen compound metabolic process
GO:0051716	0.950	cellular response to stimulus
GO:0060255	0.938	regulation of macromolecule metabolic process
GO:0007154	0.922	cell communication
GO:0023052	0.921	signaling
GO:0009893	0.914	positive regulation of metabolic process
GO:0010604	0.896	positive regulation of macromolecule metabolic process
GO:0051246	0.891	regulation of protein metabolic process
GO:0051173	0.871	positive regulation of nitrogen compound metabolic process
GO:1903320	0.866	regulation of protein modification by small protein conjugation or removal
GO:0007165	0.864	signal transduction
GO:0051247	0.847	positive regulation of protein metabolic process
GO:0042221	0.804	response to chemical
GO:0034097	0.780	response to cytokine
GO:0070887	0.778	cellular response to chemical stimulus
GO:0031401	0.756	positive regulation of protein modification process
GO:1990868	0.744	response to chemokine
GO:1903322	0.732	positive regulation of protein modification by small protein conjugation or removal
GO:0071345	0.715	cellular response to cytokine stimulus
GO:0007166	0.702	cell surface receptor signaling pathway
GO:0019221	0.681	cytokine-mediated signaling pathway
GO:0031396	0.676	regulation of protein ubiquitination
GO:0032502	0.428	developmental process
GO:0048856	0.423	anatomical structure development
GO:0031398	0.330	positive regulation of protein ubiquitination
GO:1990869	0.318	cellular response to chemokine

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0016020	0.999	membrane
GO:0071944	0.922	cell periphery
GO:0005886	0.901	plasma membrane
GO:0012505	0.736	endomembrane system
GO:0031090	0.655	organelle membrane
GO:0005634	0.547	nucleus
GO:0070013	0.370	intracellular organelle lumen
GO:0031982	0.362	vesicle
GO:0031410	0.333	cytoplasmic vesicle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]