StarFunc result for job id Q9NX95

User Input

>input (663 residues)
MGPLRESKKEHRVQHHDKEISRSRIPRLILRPHMPQQQHKVSPASESPFSEEESREFNPS
SSGRSARTVSSNSFCSDDTGCPSSQSVSPVKTPSDAGNSPIGFCPGSDEGFTRKKCTIGM
VGEGSIQSSRYKKESKSGLVKPGSEADFSSSSSTGSISAPEVHMSTAGSKRSSSSRNRGP
HGRSNGASSHKPGSSPSSPREKDLLSMLCRNQLSPVNIHPSYAPSSPSSSNSGSYKGSDC
SPIMRRSGRYMSCGENHGVRPPNPEQYLTPLQQKEVTVRHLKTKLKESERRLHERESEIV
ELKSQLARMREDWIEEECHRVEAQLALKEARKEIKQLKQVIETMRSSLADKDKGIQKYFV
DINIQNKKLESLLQSMEMAHSGSLRDELCLDFPCDSPEKSLTLNPPLDTMADGLSLEEQV
TGEGADRELLVGDSIANSTDLFDEIVTATTTESGDLELVHSTPGANVLELLPIVMGQEEG
SVVVERAVQTDVVPYSPAISELIQSVLQKLQDPCPSSLASPDESEPDSMESFPESLSALV
VDLTPRNPNSAILLSPVETPYANVDAEVHANRLMRELDFAACVEERLDGVIPLARGGVVR
QYWSSSFLVDLLAVAAPVVPTVLWAFSTQRGGTDPVYNIGALLRGCCVVALHSLRRTAFR
IKT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0C4DG86	0.312	0.310	4.261E-86	668	1.000	0.993	A0A0C4DG86.pdb.gz	A0A0C4DG86_HUMAN Syntabulin OS=Homo sapiens OX=9606 GN=SYBU PE=1 SV=1
2	AFDB:A0A2R9YJG3	0.289	0.303	1.642E-33	628	0.433	0.457	A0A2R9YJG3.pdb.gz
3	AFDB:Q8IQ73	0.080	0.053	1.382E-4	1107	0.163	0.098	Q8IQ73.pdb.gz	Q8IQ73_DROME Cornetto, isoform C OS=Drosophila melanogaster OX=7227 GN=corn PE=4 SV=2
4	AFDB:U3JAG9	0.123	0.084	2.398E-4	1113	0.149	0.089	U3JAG9.pdb.gz	CP131_DANRE Centrosomal protein of 131 kDa OS=Danio rerio OX=7955 GN=cep131 PE=1 SV=1
5	AFDB:Q9VMU5	0.065	0.061	2.948E-4	721	0.121	0.111	Q9VMU5.pdb.gz	QTC_DROME Protein quick-to-court OS=Drosophila melanogaster OX=7227 GN=qtc PE=2 SV=2
6	AFDB:I3L2J8	0.104	0.070	5.480E-4	1047	0.151	0.096	I3L2J8.pdb.gz	I3L2J8_HUMAN Centrosomal protein 131 OS=Homo sapiens OX=9606 GN=CEP131 PE=1 SV=1
7	AFDB:H2KY58	0.055	0.049	6.105E-3	748	0.136	0.120	H2KY58.pdb.gz	H2KY58_CAEEL ALG-1 OS=Caenorhabditis elegans OX=6239 GN=ain-2 PE=1 SV=1
8	AFDB:Q62036	0.101	0.068	6.105E-3	1060	0.142	0.089	Q62036.pdb.gz	CP131_MOUSE Centrosomal protein of 131 kDa OS=Mus musculus OX=10090 GN=Cep131 PE=1 SV=2
9	AFDB:O44757	0.050	0.034	7.007E-3	1312	0.101	0.051	O44757.pdb.gz	LIN59_CAEEL Probable histone-lysine N-methyltransferase lin-59 OS=Caenorhabditis elegans OX=6239 GN=lin-59 PE=2 SV=1
10	AFDB:Q7KVW5	0.065	0.049	1.135E-2	927	0.124	0.088	Q7KVW5.pdb.gz	KCNN_DROME Small conductance calcium-activated potassium channel protein OS=Drosophila melanogaster OX=7227 GN=SK PE=2 SV=2
11	PDB:6wotA	0.060	0.013	5.782	4197	0.020	0.003	6wotA.pdb.gz	Structural mechanism of two gain-of-function cardiac and skeletal RyR mutations at an equivalent site by cryo-EM.
12	PDB:7btbm	0.038	0.050	5.782	469	0.041	0.058	7btbm.pdb.gz	Structural insights into assembly of the ribosomal nascent polypeptide exit tunnel.
13	PDB:3h87C	0.041	0.181	8.159	72	0.021	0.194	3h87C.pdb.gz	The crystal structure of the Rv0301-Rv0300 VapBC-3 toxin-antitoxin complex from M. tuberculosis reveals a Mg(2+) ion in the active site and a putative RNA-binding site.
14	PDB:4v6wCC	0.061	0.092	9.364	392	0.017	0.028	4v6wCC.pdb.gz	Structures of the human and Drosophila 80S ribosome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0C4DG86	0.0	1345	668	1.000	0.993	A0A0C4DG86_HUMAN Syntabulin OS=Homo sapiens OX=9606 GN=SYBU PE=1 SV=1
2	A0A8I5ZLI6	0.0	975	593	0.762	0.852	A0A8I5ZLI6_RAT Syntabulin OS=Rattus norvegicus OX=10116 GN=Sybu PE=4 SV=1
3	A0A8I6A508	0.0	1073	788	0.866	0.728	A0A8I6A508_RAT Syntabulin OS=Rattus norvegicus OX=10116 GN=Sybu PE=4 SV=1
4	A0A8I6AS68	0.0	1076	684	0.866	0.839	A0A8I6AS68_RAT Syntabulin OS=Rattus norvegicus OX=10116 GN=Sybu PE=4 SV=1
5	B3KRD1	0.0	938	457	0.689	1.000	B3KRD1_HUMAN Syntabulin OS=Homo sapiens OX=9606 GN=SYBU PE=1 SV=1
6	B7Z4D2	0.0	1060	533	0.784	0.976	B7Z4D2_HUMAN Syntabulin OS=Homo sapiens OX=9606 GN=SYBU PE=1 SV=1
7	F1LUC0	0.0	1069	664	0.864	0.863	F1LUC0_RAT Syntabulin OS=Rattus norvegicus OX=10116 GN=Sybu PE=1 SV=3
8	Q9NX95	0.0	1351	663	1.000	1.000	SYBU_HUMAN Syntabulin OS=Homo sapiens OX=9606 GN=SYBU PE=1 SV=2
9	Q08CJ9	2.28e-141	428	628	0.454	0.479	Q08CJ9_DANRE Syntabulin OS=Danio rerio OX=7955 GN=zgc:153017 PE=2 SV=1
10	D3KVM2	1.62e-115	357	506	0.367	0.480	D3KVM2_DANRE Syntabulin OS=Danio rerio OX=7955 GN=syn PE=4 SV=1
11	O15079	4.50e-93	298	494	0.290	0.389	SNPH_HUMAN Syntaphilin OS=Homo sapiens OX=9606 GN=SNPH PE=1 SV=2
12	Q80U23	6.49e-92	295	495	0.290	0.388	SNPH_MOUSE Syntaphilin OS=Mus musculus OX=10090 GN=Snph PE=1 SV=3
13	B5DF41	2.87e-87	283	504	0.285	0.375	SNPH_RAT Syntaphilin OS=Rattus norvegicus OX=10116 GN=Snph PE=1 SV=1
14	Q6FUY8	0.071	38.9	1883	0.047	0.016	Q6FUY8_CANGA Fatty acid synthase subunit alpha OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=CAGL0E06138g PE=3 SV=1
15	Q60902	0.092	38.5	907	0.048	0.035	EP15R_MOUSE Epidermal growth factor receptor substrate 15-like 1 OS=Mus musculus OX=10090 GN=Eps15l1 PE=1 SV=3
16	A0A8I6ALR5	0.094	38.5	909	0.044	0.032	A0A8I6ALR5_RAT PPFIA binding protein 2 OS=Rattus norvegicus OX=10116 GN=Ppfibp2 PE=1 SV=1
17	A0A0G2K383	0.11	38.1	970	0.041	0.028	A0A0G2K383_RAT PPFIA binding protein 2 OS=Rattus norvegicus OX=10116 GN=Ppfibp2 PE=1 SV=1
18	A0A8I5ZVX1	0.11	38.1	981	0.041	0.028	A0A8I5ZVX1_RAT PPFIA binding protein 2 OS=Rattus norvegicus OX=10116 GN=Ppfibp2 PE=1 SV=1
19	Q9UBC2	0.11	38.1	864	0.048	0.037	EP15R_HUMAN Epidermal growth factor receptor substrate 15-like 1 OS=Homo sapiens OX=9606 GN=EPS15L1 PE=1 SV=1
20	G3V9H6	0.15	37.7	799	0.041	0.034	G3V9H6_RAT PPFIA binding protein 2 OS=Rattus norvegicus OX=10116 GN=Ppfibp2 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02601 Exonuc_VII_L	34	15.4	Exonuclease VII, large subunit
2	PF06818 Fez1	0.24	23.3	Fez1
3	PF05911 FPP	3e+02	11.0	Filament-like plant protein, long coiled-coil
4	PF15905 HMMR_N	79	14.1	Hyaluronan mediated motility receptor N-terminal
5	PF16808 PKcGMP_CC	17	16.5	Coiled-coil N-terminus of cGMP-dependent protein kinase
6	PF06428 Sec2p	4.9e+02	12.1	GDP/GTP exchange factor Sec2p
7	PF04048 Sec8_exocyst	4.4e+02	12.2	Sec8 exocyst complex component specific domain
8	PF15290 Syntaphilin	5.3e-138	471.4	Golgi-localised syntaxin-1-binding clamp

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000407118

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000307078	0.976	Kinesin-1 heavy chain
2	9606.ENSP00000321826	0.812	Syntaxin-binding protein 5
3	9606.ENSP00000296452	0.772	Protein bassoon
4	9606.ENSP00000222812	0.750	Syntaxin-1A
5	9606.ENSP00000351206	0.733	Beta-taxilin
6	9606.ENSP00000408979	0.696	Kinesin heavy chain isoform 5A
7	9606.ENSP00000282369	0.684	E3 ubiquitin-protein ligase TRIM36
8	9606.ENSP00000328998	0.670	Trafficking kinesin-binding protein 1
9	9606.ENSP00000215095	0.660	Syntaxin-1B
10	9606.ENSP00000263354	0.650	Alpha-soluble NSF attachment protein
11	9606.ENSP00000328875	0.649	Trafficking kinesin-binding protein 2
12	9606.ENSP00000345656	0.644	Vesicle-associated membrane protein-associated protein A
13	9606.ENSP00000239690	0.630	NudC domain containing 1
14	9606.ENSP00000254976	0.620	Synaptosomal-associated protein 25
15	9606.ENSP00000278919	0.595	Fasciculation and elongation protein zeta-1
16	9606.ENSP00000351132	0.582	Mitochondrial Rho GTPase 1
17	9606.ENSP00000253925	0.579	Liprin-alpha-1
18	9606.ENSP00000246112	0.562	Transducin-like enhancer protein 6
19	9606.ENSP00000256362	0.558	Vertnin
20	9606.ENSP00000283195	0.558	E3 SUMO-protein ligase RanBP2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050803	0.998	regulation of synapse structure or activity
GO:0099177	0.998	regulation of trans-synaptic signaling
GO:0016482	0.998	cytosolic transport
GO:0008089	0.998	anterograde axonal transport
GO:0047497	0.998	mitochondrion transport along microtubule
GO:0035774	0.998	positive regulation of insulin secretion involved in cellular response to glucose stimulus
GO:0021700	0.997	developmental maturation
GO:0047496	0.997	vesicle transport along microtubule
GO:0016043	0.995	cellular component organization
GO:0050808	0.981	synapse organization
GO:0032501	0.971	multicellular organismal process
GO:0050804	0.962	modulation of chemical synaptic transmission
GO:0007275	0.916	multicellular organism development
GO:0048731	0.811	system development
GO:0007399	0.741	nervous system development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043227	1.000	membrane-bounded organelle
GO:0005856	0.995	cytoskeleton
GO:0015630	0.994	microtubule cytoskeleton
GO:0031982	0.986	vesicle
GO:0043231	0.985	intracellular membrane-bounded organelle
GO:0005737	0.940	cytoplasm
GO:0099080	0.870	supramolecular complex
GO:0099512	0.857	supramolecular fiber
GO:0099513	0.833	polymeric cytoskeletal fiber
GO:0005874	0.788	microtubule
GO:0005829	0.559	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]