StarFunc result for job id Q9NXA8

User Input

>input (310 residues)
MRPLQIVPSRLISQLYCGLKPPASTRNQICLKMARPSSSMADFRKFFAKAKHIVIISGAG
VSAESGVPTFRGAGGYWRKWQAQDLATPLAFAHNPSRVWEFYHYRREVMGSKEPNAGHRA
IAECETRLGKQGRRVVVITQNIDELHRKAGTKNLLEIHGSLFKTRCTSCGVVAENYKSPI
CPALSGKGAPEPGTQDASIPVEKLPRCEEAGCGGLLRPHVVWFGENLDPAILEEVDRELA
HCDLCLVVGTSSVVYPAAMFAPQVAARGVPVAEFNTETTPATNRFRFHFQGPCGTTLPEA
LACHENETVS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A024R012	0.916	0.916	8.092E-64	310	1.000	1.000	A0A024R012.pdb.gz
2	AFDB:Q68FX9	0.952	0.952	1.197E-59	310	0.855	0.855	Q68FX9.pdb.gz	SIR5_RAT NAD-dependent protein deacylase sirtuin-5, mitochondrial OS=Rattus norvegicus OX=10116 GN=Sirt5 PE=2 SV=1
3	AFDB:Q6DHI5	0.897	0.912	2.948E-51	305	0.687	0.698	Q6DHI5.pdb.gz	SIR5_DANRE NAD-dependent protein deacylase sirtuin-5, mitochondrial OS=Danio rerio OX=7955 GN=sirt5 PE=1 SV=1
4	PDB:6fkyB	0.810	0.938	1.824E-41	266	0.648	0.756	6fkyB.pdb.gz	Potent and Selective Inhibitors of Human Sirtuin 5.
5	AFDB:P75960	0.665	0.736	2.551E-23	279	0.284	0.315	P75960.pdb.gz	NPD_ECOLI NAD-dependent protein deacylase OS=Escherichia coli (strain K12) OX=83333 GN=cobB PE=1 SV=3
6	AFDB:Q584D5	0.676	0.850	2.393E-22	244	0.284	0.361	Q584D5.pdb.gz	SIR5_TRYB2 NAD-dependent protein deacylase SIR2rp3 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=SIR2rp3 PE=3 SV=1
7	AFDB:B4EVF5	0.661	0.716	2.538E-22	285	0.284	0.309	B4EVF5.pdb.gz	NPD_PROMH NAD-dependent protein deacylase OS=Proteus mirabilis (strain HI4320) OX=529507 GN=npdA PE=1 SV=1
8	AFDB:P9WGG3	0.654	0.846	3.834E-22	237	0.297	0.388	P9WGG3.pdb.gz	NPD_MYCTU NAD-dependent protein deacylase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=cobB PE=1 SV=1
9	AFDB:A0R2N3	0.634	0.812	1.174E-21	240	0.287	0.371	A0R2N3.pdb.gz	NDP_MYCS2 NAD-dependent protein deacylase Sir2 OS=Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) OX=246196 GN=sir2 PE=1 SV=1
10	AFDB:Q8IE47	0.695	0.784	1.394E-20	273	0.248	0.282	Q8IE47.pdb.gz	SIR2A_PLAF7 NAD-dependent protein deacylase Sir2A OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=Sir2A PE=1 SV=1
11	PDB:3u31A	0.686	0.800	2.331E-20	263	0.245	0.289	3u31A.pdb.gz	Plasmodium falciparum Sir2A Preferentially Hydrolyzes Medium and Long Chain Fatty Acyl Lysine
12	AFDB:Q8IRR5	0.684	0.680	2.512E-20	312	0.258	0.256	Q8IRR5.pdb.gz	SIR4_DROME NAD-dependent protein deacylase Sirt4 OS=Drosophila melanogaster OX=7227 GN=Sirt4 PE=2 SV=2
13	PDB:7cl1A	0.549	0.574	8.301E-15	296	0.181	0.189	7cl1A.pdb.gz	Reply to: Binding site for MDL-801 on SIRT6.
14	PDB:5fyqA	0.646	0.705	3.218E-14	282	0.213	0.234	5fyqA.pdb.gz	Insights Into Lysine-Deacetylation of Natively Folded Substrate Proteins by Sirtuins.
15	PDB:1q14A	0.609	0.649	1.247E-13	289	0.223	0.239	1q14A.pdb.gz	Structure and autoregulation of the Yeast Hst2 homolog of Sir2
16	PDB:4o9uB	0.341	0.246	7.394E-4	440	0.110	0.077	4o9uB.pdb.gz	Structural biology. Division of labor in transhydrogenase by alternating proton translocation and hydride transfer.
17	PDB:6hyjB	0.357	0.463	1.256E-3	223	0.116	0.161	6hyjB.pdb.gz	Crystal structures and snapshots along the reaction pathway of human phosphoserine phosphatase.
18	PDB:2paaA	0.284	0.223	2.534E-2	413	0.094	0.070	2paaA.pdb.gz	X-ray analysis of phosphoglycerate kinase 2, a sperm-specific isoform from Mus musculus.
19	PDB:1qpgA	0.281	0.219	2.851E-2	415	0.113	0.084	1qpgA.pdb.gz	Structure of the R65Q mutant of yeast 3-phosphoglycerate kinase complexed with Mg-AMP-PNP and 3-phospho-D-glycerate.
20	PDB:7awtG	0.235	0.091	2.851E-2	907	0.103	0.035	7awtG.pdb.gz	Structure of the peripheral arm of a minimalistic respiratory complex I.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q68FX9	0.0	546	310	0.855	0.855	SIR5_RAT NAD-dependent protein deacylase sirtuin-5, mitochondrial OS=Rattus norvegicus OX=10116 GN=Sirt5 PE=2 SV=1
2	Q8K2C6	0.0	549	310	0.861	0.861	SIR5_MOUSE NAD-dependent protein deacylase sirtuin-5, mitochondrial OS=Mus musculus OX=10090 GN=Sirt5 PE=1 SV=1
3	Q9NXA8	0.0	643	310	1.000	1.000	SIR5_HUMAN NAD-dependent protein deacylase sirtuin-5, mitochondrial OS=Homo sapiens OX=9606 GN=SIRT5 PE=1 SV=2
4	Q6DHI5	9.31e-157	442	305	0.674	0.685	SIR5_DANRE NAD-dependent protein deacylase sirtuin-5, mitochondrial OS=Danio rerio OX=7955 GN=sirt5 PE=1 SV=1
5	P9WGG3	1.17e-47	161	237	0.323	0.422	NPD_MYCTU NAD-dependent protein deacylase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=cobB PE=1 SV=1
6	A0R2N3	1.85e-47	161	240	0.316	0.408	NDP_MYCS2 NAD-dependent protein deacylase Sir2 OS=Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) OX=246196 GN=sir2 PE=1 SV=1
7	P75960	3.81e-46	159	279	0.290	0.323	NPD_ECOLI NAD-dependent protein deacylase OS=Escherichia coli (strain K12) OX=83333 GN=cobB PE=1 SV=3
8	Q584D5	2.59e-44	153	244	0.300	0.381	SIR5_TRYB2 NAD-dependent protein deacylase SIR2rp3 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=SIR2rp3 PE=3 SV=1
9	B4EVF5	3.73e-44	154	285	0.297	0.323	NPD_PROMH NAD-dependent protein deacylase OS=Proteus mirabilis (strain HI4320) OX=529507 GN=npdA PE=1 SV=1
10	Q8IE47	1.41e-36	134	273	0.255	0.289	SIR2A_PLAF7 NAD-dependent protein deacylase Sir2A OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=Sir2A PE=1 SV=1
11	D3YT50	3.12e-30	122	577	0.271	0.146	D3YT50_CAEEL Deacetylase sirtuin-type domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=sir-2.1 PE=1 SV=1
12	Q21921	3.88e-30	122	607	0.271	0.138	SIR2_CAEEL NAD-dependent protein deacetylase sir-2.1 OS=Caenorhabditis elegans OX=6239 GN=sir-2.1 PE=1 SV=1
13	Q8R216	8.64e-28	112	333	0.252	0.234	SIR4_MOUSE NAD-dependent protein lipoamidase sirtuin-4, mitochondrial OS=Mus musculus OX=10090 GN=Sirt4 PE=1 SV=3
14	G3V641	1.67e-27	110	311	0.242	0.241	G3V641_RAT NAD-dependent protein lipoamidase sirtuin-4, mitochondrial OS=Rattus norvegicus OX=10116 GN=Sirt4 PE=3 SV=1
15	Q9Y6E7	1.73e-27	110	314	0.255	0.252	SIR4_HUMAN NAD-dependent protein lipoamidase sirtuin-4, mitochondrial OS=Homo sapiens OX=9606 GN=SIRT4 PE=1 SV=1
16	A0A0G2K6D8	1.74e-27	110	319	0.242	0.235	A0A0G2K6D8_RAT NAD-dependent protein lipoamidase sirtuin-4, mitochondrial OS=Rattus norvegicus OX=10116 GN=Sirt4 PE=3 SV=1
17	Q1JQC6	2.65e-27	110	315	0.258	0.254	SIR4_BOVIN NAD-dependent protein lipoamidase sirtuin-4, mitochondrial OS=Bos taurus OX=9913 GN=SIRT4 PE=2 SV=1
18	Q8IRR5	2.05e-25	105	312	0.265	0.263	SIR4_DROME NAD-dependent protein deacylase Sirt4 OS=Drosophila melanogaster OX=7227 GN=Sirt4 PE=2 SV=2
19	B2RZ30	1.38e-23	99.8	283	0.213	0.233	B2RZ30_RAT Sirt4 protein OS=Rattus norvegicus OX=10116 GN=Sirt4 PE=2 SV=1
20	P66815	1.43e-23	99.0	243	0.235	0.300	NPD_STAAM NAD-dependent protein deacetylase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) OX=158878 GN=cobB PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02233 PNTB	0.047	24.3	NAD(P) transhydrogenase beta subunit
2	PF02146 SIR2	6.6e-43	158.2	Sir2 family
3	PF00205 TPP_enzyme_M	34	15.6	Thiamine pyrophosphate enzyme, central domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000476228

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000222553	0.977	Nicotinamide phosphoribosyltransferase
2	9606.ENSP00000307786	0.958	Cytochrome c
3	9606.ENSP00000441434	0.944	Nicotinamide N-methyltransferase
4	9606.ENSP00000476960	0.936	Histone cluster 2 H3 pseudogene 2
5	9606.ENSP00000354532	0.930	Purine nucleoside phosphorylase
6	9606.ENSP00000326424	0.929	Glutamine-dependent NAD(+) synthetase
7	9606.ENSP00000264663	0.927	NAD(P) transhydrogenase, mitochondrial
8	9606.ENSP00000230792	0.916	Peroxisomal NADH pyrophosphatase NUDT12
9	9606.ENSP00000371362	0.911	NAD kinase 2, mitochondrial
10	9606.ENSP00000366410	0.885	Nicotinamide/nicotinic acid mononucleotide adenylyltransferase 1
11	9606.ENSP00000295757	0.871	Histone deacetylase 11
12	9606.ENSP00000340523	0.867	Nicotinamide/nicotinic acid mononucleotide adenylyltransferase 3
13	9606.ENSP00000482271	0.856	Histone cluster 1 H3 family member e
14	9606.ENSP00000484658	0.856	Histone cluster 1 H3 family member c
15	9606.ENSP00000366999	0.854	Histone cluster 1 H3 family member d
16	9606.ENSP00000287713	0.853	Nicotinamide/nicotinic acid mononucleotide adenylyltransferase 2
17	9606.ENSP00000352252	0.849	Histone cluster 1 H3 family member j
18	9606.ENSP00000358160	0.849	Histone cluster 1 H3 family member h
19	9606.ENSP00000480826	0.849	Histone cluster 1 H3 family member a
20	9606.ENSP00000483283	0.849	Histone cluster 1 H3 family member i

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0016811	0.999	hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in linear amides
GO:0033558	0.999	protein lysine deacetylase activity
GO:1901363	0.998	heterocyclic compound binding
GO:0097159	0.997	organic cyclic compound binding
GO:0034979	0.994	NAD-dependent protein deacetylase activity
GO:0005515	0.984	protein binding
GO:0016740	0.726	transferase activity
GO:0051287	0.711	NAD binding
GO:0046914	0.694	transition metal ion binding
GO:0008270	0.672	zinc ion binding
GO:0004407	0.606	histone deacetylase activity
GO:0070403	0.571	NAD+ binding
GO:0003676	0.345	nucleic acid binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065007	0.998	biological regulation
GO:0044238	0.997	primary metabolic process
GO:0006807	0.995	nitrogen compound metabolic process
GO:0043412	0.995	macromolecule modification
GO:0031323	0.994	regulation of cellular metabolic process
GO:0009987	0.987	cellular process
GO:0019538	0.985	protein metabolic process
GO:0018205	0.980	peptidyl-lysine modification
GO:0048519	0.973	negative regulation of biological process
GO:0098732	0.972	macromolecule deacylation
GO:0048523	0.917	negative regulation of cellular process
GO:0035601	0.883	protein deacylation
GO:0050896	0.801	response to stimulus
GO:2000377	0.720	regulation of reactive oxygen species metabolic process
GO:0071840	0.620	cellular component organization or biogenesis
GO:0016043	0.575	cellular component organization
GO:0009892	0.570	negative regulation of metabolic process
GO:0031324	0.539	negative regulation of cellular metabolic process
GO:0009889	0.481	regulation of biosynthetic process
GO:0060255	0.448	regulation of macromolecule metabolic process
GO:0051171	0.409	regulation of nitrogen compound metabolic process
GO:0048518	0.405	positive regulation of biological process
GO:0080090	0.402	regulation of primary metabolic process
GO:0031326	0.396	regulation of cellular biosynthetic process
GO:0044237	0.368	cellular metabolic process
GO:0006950	0.358	response to stress
GO:0051716	0.339	cellular response to stimulus
GO:0006476	0.325	protein deacetylation
GO:0048522	0.320	positive regulation of cellular process
GO:0043067	0.315	regulation of programmed cell death
GO:0010468	0.313	regulation of gene expression

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	0.995	mitochondrion
GO:0005634	0.976	nucleus
GO:0070013	0.973	intracellular organelle lumen
GO:0005829	0.774	cytosol
GO:0016020	0.711	membrane
GO:0005740	0.550	mitochondrial envelope
GO:0005654	0.397	nucleoplasm
GO:0032991	0.351	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.5.1.-	0.999	In linear amides.
RHEA:58108	0.999	H2O + N(6)-acetyl-L-lysyl-[protein] = acetate + L-lysyl-[protein]
EC:2.-.-.-	0.726	Transferases.
RHEA:58196	0.606	H2O + N(6)-acetyl-L-lysyl-[histone] = acetate + L-lysyl-[histone]
EC:3.5.1.98	0.606	histone deacetylase.

[back to server]