StarFunc result for job id Q9NXE4

User Input

>input (866 residues)
MTTFGAVAEWRLPSLRRATLWIPQWFAKKAIFNSPLEAAMAFPHLQQPSFLLASLKADSI
NKPFAQQCQDLVKVIEDFPAKELHTIFPWLVESIFGSLDGVLVGWNLRCLQGRVNPVEYS
IVMEFLDPGGPMMKLVYKLQAEDYKFDFPVSYLPGPVKASIQECILPDSPLYHNKVQFTP
TGGLGLNLALNPFEYYIFFFALSLITQKPLPVSLHVRTSDCAYFILVDRYLSWFLPTEGS
VPPPLSSSPGGTSPSPPPRTPAIPFASYGLHHTSLLKRHISHQTSVNADPASHEIWRSET
LLQVFVEMWLHHYSLEMYQKMQSPHAKLEVLHYRLSVSSALYSPAQPSLQALHAYQESFT
PTEEHVLVVRLLLKHLHAFANSLKPEQASPSAHSHATSPLEEFKRAAVPRFVQQKLYLFL
QHCFGHWPLDASFRAVLEMWLSYLQPWRYAPDKQAPGSDSQPRCVSEKWAPFVQENLLMY
TKLFVGFLNRALRTDLVSPKHALMVFRVAKVFAQPNLAEMIQKGEQLFLEPELVIPHRQH
RLFTAPTFTGSFLSPWPPAVTDASFKVKSHVYSLEGQDCKYTPMFGPEARTLVLRLAQLI
TQAKHTAKSISDQCAESPAGHSFLSWLGFSSMDTNGSYTANDLDEMGQDSVRKTDEYLEK
ALEYLRQIFRLSEAQLRQFTLALGTTQDENGKKQLPDCIVGEDGLILTPLGRYQIINGLR
RFEIEYQGDPELQPIRSYEIASLVRTLFRLSSAINHRFAGQMAALCSRDDFLGSFCRYHL
TEPGLASRHLLSPVGRRQVAGHTRGPRLSLRFLGSYRTLVSLLLAFFVASLFCVGPLPCT
LLLTLGYVLYASAMTLLTERGKLHQP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9NXE4	1.000	1.000	0.000	866	1.000	1.000	Q9NXE4.pdb.gz	NSMA3_HUMAN Sphingomyelin phosphodiesterase 4 OS=Homo sapiens OX=9606 GN=SMPD4 PE=1 SV=3
2	AFDB:Q08972	0.117	0.094	3.181E-3	1196	0.104	0.075	Q08972.pdb.gz	NEW1_YEAST [NU+] prion formation protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=NEW1 PE=1 SV=1
3	AFDB:B3DJT0	0.090	0.085	1.290E-2	951	0.102	0.093	B3DJT0.pdb.gz	SART3_DANRE Squamous cell carcinoma antigen recognized by T-cells 3 OS=Danio rerio OX=7955 GN=sart3 PE=2 SV=1
4	PDB:4a0cA	0.088	0.074	1.614E-2	1155	0.096	0.072	4a0cA.pdb.gz	The Molecular Basis of Crl4(Ddb2/Csa) Ubiquitin Ligase Architecture, Targeting, and Activation
5	PDB:3gjxA	0.086	0.078	1.903E-2	1041	0.106	0.088	3gjxA.pdb.gz	Crystal Structure of the Nuclear Export Receptor CRM1 in Complex with Snurportin1 and RanGTP.
6	PDB:7pkse	0.097	0.119	1.983E-2	649	0.060	0.080	7pkse.pdb.gz	Structural basis of Integrator-mediated transcription regulation.
7	AFDB:Q9W350	0.090	0.055	2.940E-2	1742	0.130	0.065	Q9W350.pdb.gz	Q9W350_DROME C11.1, isoform A OS=Drosophila melanogaster OX=7227 GN=c11.1 PE=1 SV=2
8	AFDB:Q4GYI6	0.083	0.081	4.437E-2	907	0.114	0.109	Q4GYI6.pdb.gz	Q4GYI6_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=TB927.1.3910 PE=4 SV=1
9	AFDB:Q6WWW4	0.088	0.052	4.624E-2	1888	0.119	0.055	Q6WWW4.pdb.gz	UPL3_ARATH E3 ubiquitin-protein ligase UPL3 OS=Arabidopsis thaliana OX=3702 GN=UPL3 PE=1 SV=1
10	PDB:3wyfC	0.104	0.090	4.709E-2	1040	0.091	0.076	3wyfC.pdb.gz	Structural insights into how yrb2p accelerates the assembly of the xpo1p nuclear export complex
11	PDB:7p3xB	0.104	0.124	5.113E-2	621	0.114	0.159	7p3xB.pdb.gz
12	AFDB:A0A1D8PTY4	0.125	0.100	5.452E-2	1195	0.082	0.059	A0A1D8PTY4.pdb.gz	A0A1D8PTY4_CANAL Elf1p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ELF1 PE=3 SV=1
13	PDB:5yu7A	0.093	0.078	5.552E-2	1118	0.091	0.071	5yu7A.pdb.gz
14	AFDB:F4IPA6	0.100	0.112	5.681E-2	744	0.106	0.124	F4IPA6.pdb.gz	F4IPA6_ARATH ARM repeat superfamily protein OS=Arabidopsis thaliana OX=3702 GN=VAC1 PE=1 SV=1
15	PDB:7lt3C	0.086	0.035	5.786E-2	3720	0.111	0.026	7lt3C.pdb.gz	Structural basis of long-range to short-range synaptic transition in NHEJ.
16	AFDB:P48563	0.111	0.076	6.428E-2	1636	0.099	0.053	P48563.pdb.gz	MON2_YEAST Protein MON2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MON2 PE=1 SV=1
17	AFDB:Q54P76	0.088	0.072	7.273E-2	1182	0.092	0.068	Q54P76.pdb.gz	EXOC4_DICDI Exocyst complex component 4 OS=Dictyostelium discoideum OX=44689 GN=exoc4 PE=3 SV=1
18	PDB:7wooC	0.097	0.072	9.101E-2	1325	0.096	0.063	7wooC.pdb.gz
19	PDB:7mq8LM	0.095	0.055	9.882E-2	2005	0.109	0.047	7mq8LM.pdb.gz	Nucleolar maturation of the human small subunit processome.
20	PDB:3w3uA	0.085	0.076	1.214E-1	1030	0.102	0.085	3w3uA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q6ZPR5	0.0	1485	823	0.857	0.902	NSMA3_MOUSE Sphingomyelin phosphodiesterase 4 OS=Mus musculus OX=10090 GN=Smpd4 PE=1 SV=2
2	Q9NXE4	0.0	1779	866	1.000	1.000	NSMA3_HUMAN Sphingomyelin phosphodiesterase 4 OS=Homo sapiens OX=9606 GN=SMPD4 PE=1 SV=3
3	Q14919	4.3	32.7	205	0.018	0.078	NC2A_HUMAN Dr1-associated corepressor OS=Homo sapiens OX=9606 GN=DRAP1 PE=1 SV=3
4	Q57ZG1	6.0	33.1	2068	0.035	0.015	Q57ZG1_TRYB2 RanBP2-type domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.27E10.570 PE=4 SV=1
5	Q9C0D2	8.8	32.7	2601	0.038	0.013	CE295_HUMAN Centrosomal protein of 295 kDa OS=Homo sapiens OX=9606 GN=CEP295 PE=1 SV=4

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF14724 mit_SMPDase	0	1646.7	Mitochondrial-associated sphingomyelin phosphodiesterase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000386531

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000219334	0.979	Sphingomyelin phosphodiesterase 3
2	9606.ENSP00000258052	0.963	Sphingomyelin phosphodiesterase 2
3	9606.ENSP00000363397	0.948	Ceramide glucosyltransferase
4	9606.ENSP00000216264	0.945	Ceramide kinase
5	9606.ENSP00000311648	0.940	2-hydroxyacylsphingosine 1-beta-galactosyltransferase
6	9606.ENSP00000340409	0.937	Sphingomyelin phosphodiesterase
7	9606.ENSP00000261304	0.929	Galactocerebrosidase
8	9606.ENSP00000354829	0.918	Phosphatidylcholine:ceramide cholinephosphotransferase 1
9	9606.ENSP00000378176	0.911	Phosphatidylcholine:ceramide cholinephosphotransferase 2
10	9606.ENSP00000332656	0.907	Ectonucleotide pyrophosphatase/phosphodiesterase family member 7
11	9606.ENSP00000307126	0.849	Sphingolipid delta(4)-desaturase/C4-monooxygenase DES2
12	9606.ENSP00000376453	0.839	Ceramide synthase 6
13	9606.ENSP00000271688	0.829	Ceramide synthase 2
14	9606.ENSP00000342609	0.822	Alkaline ceramidase 2
15	9606.ENSP00000251363	0.819	Ceramide synthase 4
16	9606.ENSP00000371152	0.819	Acid ceramidase
17	9606.ENSP00000301452	0.800	Alkaline ceramidase 1
18	9606.ENSP00000316476	0.799	Sphingolipid delta(4)-desaturase DES1
19	9606.ENSP00000378897	0.788	Neutral ceramidase
20	9606.ENSP00000284382	0.783	Ceramide synthase 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008081	1.000	phosphoric diester hydrolase activity
GO:0004620	1.000	phospholipase activity
GO:0050290	0.981	sphingomyelin phosphodiesterase D activity
GO:0004767	0.806	sphingomyelin phosphodiesterase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0044238	0.989	primary metabolic process
GO:0044237	0.989	cellular metabolic process
GO:1901564	0.986	organonitrogen compound metabolic process
GO:0006629	0.978	lipid metabolic process
GO:0006665	0.969	sphingolipid metabolic process
GO:0044249	0.957	cellular biosynthetic process
GO:0008610	0.955	lipid biosynthetic process
GO:1901566	0.940	organonitrogen compound biosynthetic process
GO:0043603	0.936	amide metabolic process
GO:0030148	0.914	sphingolipid biosynthetic process
GO:0034641	0.878	cellular nitrogen compound metabolic process
GO:0006672	0.878	ceramide metabolic process
GO:0044271	0.871	cellular nitrogen compound biosynthetic process
GO:0050896	0.852	response to stimulus
GO:0006793	0.836	phosphorus metabolic process
GO:0006796	0.833	phosphate-containing compound metabolic process
GO:0043604	0.806	amide biosynthetic process
GO:0051716	0.805	cellular response to stimulus
GO:0019637	0.797	organophosphate metabolic process
GO:0009395	0.771	phospholipid catabolic process
GO:0046513	0.759	ceramide biosynthetic process
GO:0030149	0.757	sphingolipid catabolic process
GO:0071356	0.734	cellular response to tumor necrosis factor
GO:0048856	0.356	anatomical structure development
GO:0071840	0.347	cellular component organization or biogenesis
GO:0016043	0.320	cellular component organization
GO:0006684	0.301	sphingomyelin metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005783	1.000	endoplasmic reticulum
GO:0005635	1.000	nuclear envelope
GO:0005886	0.997	plasma membrane
GO:0005789	0.967	endoplasmic reticulum membrane
GO:0005794	0.939	Golgi apparatus
GO:0098588	0.938	bounding membrane of organelle
GO:0098791	0.465	Golgi apparatus subcompartment
GO:0031965	0.437	nuclear membrane
GO:0005802	0.364	trans-Golgi network
GO:0031968	0.352	organelle outer membrane
GO:0005640	0.302	nuclear outer membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.1.4.-	1.000	Phosphoric diester hydrolases.
RHEA:20984	0.981	a sphingomyelin + H2O = an N-acylsphing-4-enine 1-phosphate + choline + H(+)
EC:3.1.4.41	0.981	sphingomyelin phosphodiesterase D.
RHEA:19253	0.806	a sphingomyelin + H2O = an N-acylsphing-4-enine + H(+) + phosphocholine
EC:3.1.4.12	0.806	sphingomyelin phosphodiesterase.

[back to server]