StarFunc result for job id Q9NXG0

User Input

>input (1405 residues)
MAARSPPSPHPSPPARQLGPRSPRVGRGAEVHAMRSEASGFAGAAREVVADESDKIWVGE
EGSGGRRGPGGAAPAHAPLLSAPMGSRRLEGISVEEAMVTRTQLLEEELSSLKEELALCQ
ADKEFVWSLWKRLQVTNPDLTQVVSLVVEREKQKSEAKDRKVLEILQVKDAKIQEFEQRE
SVLKQEINDLVKRKIAVDEENAFLRKEFSDLEKKFKDKSQEIKDTKECVQNKEEQNRLVI
KNLEEENKKLSTRCTDLLNDLEKLRKQEAHLRKEKYSTDAKIKTFEDNLIEARKEVEVSQ
SKYNALSLQLSNKQTELIQKDMDITLVRKELQELQNLYKQNSTHTAQQAELIQQLQVLNM
DTQKVLRNQEDVHTAESISYQKLYNELHICFETTKSNEAMLRQSVTNLQDQLLQKEQENA
KLKEKLQESQGAPLPLPQESDPDYSAQVPHRPSLSSLETLMVSQKSEIEYLQEKLKIANE
KLSENISANKGFSRKSIMTSAEGKHKEPPVKRSRSLSPKSSFTDSEELQKLRKAERKIEN
LEKALQLKSQENDELRDAHEKRKERLQMLQTNYRAVKEQLKQWEEGSGMTEIRKIKRADP
QQLRQEDSDAVWNELAYFKRENQELMIQKMNLEEELDELKVHISIDKAAIQELNRCVAER
REEQLFRSGEDDEVKRSTPEKNGKEMLEQTLQKVTELENRLKSFEKRSRKLKEGNKKLMK
ENDFLKSLLKQQQEDTETREKELEQIIKGSKDVEKENTELQVKISELETEVTSLRRQVAE
ANALRNENEELINPMEKSHQSADRAKSEMATMKVRSGRYDCKTTMTKVKFKAAKKNCSVG
RHHTVLNHSIKVMSNVFENLSKDGWEDVSESSSDSEAQTSQTLGTIIVETSQKISPTEDG
KDQKESDPTEDSQTQGKEIVQTYLNIDGKTPKDYFHDKNAKKPTFQKKNCKMQKSSHTAV
PTRVNREKYKNITAQKSSSNIILLRERIISLQQQNSVLQNAKKTAELSVKEYKEVNEKLL
HQQQVSDQRFQTSRQTIKKLNLDLAGLRKEKEDLLKKLESSSEITSLAEENSQVTFPRIQ
VTSLSPSRSMDLEMKQLQYKLKNATNELTKQSSNVKTLKFELLAKEEHIKEMHEKISRME
RDITMKRHLIEDLKFRQKVNLESNKSFSEMLQNLDKKVKTLTEECSNKKVSIDSLKQRLN
VAVKEKSQYEQMYQKSKEELEKKDLKLTLLVSRISETESAMAEIETAASKQLQELALQSE
QVLEGAQKTLLLANEKVEEFTTFVKALAKELQNDVHVVRRQIRELKKMKKNRDACKTSTH
KAQTLAASILNISRSDLEEILDTEDQVEIEKTKIDAENDKEWMLYIQKLLEGQSLTLSPR
LKCNGAIVAHQNLRLPDSSSSASAS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9NXG0	0.999	0.999	0.000	1405	1.000	1.000	Q9NXG0.pdb.gz	CNTLN_HUMAN Centlein OS=Homo sapiens OX=9606 GN=CNTLN PE=1 SV=6
2	AFDB:Q9LFE4	0.089	0.123	2.044E-4	853	0.111	0.183	Q9LFE4.pdb.gz	Y5673_ARATH WEB family protein At5g16730, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=At5g16730 PE=1 SV=1
3	AFDB:Q5M9N0	0.075	0.091	2.355E-4	1113	0.117	0.148	Q5M9N0.pdb.gz	CD158_HUMAN Coiled-coil domain-containing protein 158 OS=Homo sapiens OX=9606 GN=CCDC158 PE=1 SV=2
4	AFDB:F4JXK3	0.097	0.131	2.712E-4	1018	0.126	0.174	F4JXK3.pdb.gz	F4JXK3_ARATH Branched-chain amino acid aminotransferase 5 / branched-chain amino acid transaminase 5 (BCAT5) OS=Arabidopsis thaliana OX=3702 GN=ATBCAT-5 PE=1 SV=1
5	AFDB:Q8K389	0.064	0.050	3.353E-4	1822	0.161	0.124	Q8K389.pdb.gz	CK5P2_MOUSE CDK5 regulatory subunit-associated protein 2 OS=Mus musculus OX=10090 GN=Cdk5rap2 PE=1 SV=3
6	AFDB:Q5VU43	0.086	0.056	1.704E-3	2346	0.139	0.083	Q5VU43.pdb.gz	MYOME_HUMAN Myomegalin OS=Homo sapiens OX=9606 GN=PDE4DIP PE=1 SV=3
7	AFDB:Q09EF7	0.073	0.055	3.001E-3	1955	0.164	0.118	Q09EF7.pdb.gz	CROCC_CAEEL Rootletin OS=Caenorhabditis elegans OX=6239 GN=che-10 PE=2 SV=2
8	AFDB:F4ISU2	0.111	0.116	4.922E-3	1333	0.164	0.173	F4ISU2.pdb.gz	F4ISU2_ARATH Early endosome antigen OS=Arabidopsis thaliana OX=3702 GN=PICC PE=1 SV=1
9	AFDB:I0J0E7	0.091	0.103	5.282E-3	1217	0.112	0.130	I0J0E7.pdb.gz	NMCP1_ALLCE Nuclear matrix constituent protein 1 OS=Allium cepa OX=4679 GN=NMCP1 PE=2 SV=1
10	AFDB:Q9CA42	0.082	0.101	7.522E-3	1085	0.107	0.139	Q9CA42.pdb.gz	CRWN3_ARATH Protein CROWDED NUCLEI 3 OS=Arabidopsis thaliana OX=3702 GN=CRWN3 PE=1 SV=1
11	PDB:7dcoL	0.043	0.107	1.120	435	0.044	0.143	7dcoL.pdb.gz	Mechanism of spliceosome remodeling by the ATPase/helicase Prp2 and its coactivator Spp2.
12	PDB:1kmiZ	0.040	0.252	4.944	177	0.019	0.147	1kmiZ.pdb.gz	Structure and catalytic mechanism of the E. coli chemotaxis phosphatase CheZ.
13	PDB:6j6gc	0.042	0.107	4.944	436	0.031	0.101	6j6gc.pdb.gz	Structures of the Catalytically Activated Yeast Spliceosome Reveal the Mechanism of Branching.
14	PDB:5nikD	0.049	0.159	5.695	340	0.013	0.053	5nikD.pdb.gz
15	PDB:5ls9F	0.026	0.126	6.112	165	0.014	0.115	5ls9F.pdb.gz	Humanized archaeal ferritin as a tool for cell targeted delivery.
16	PDB:3gtyX	0.025	0.069	7.556	412	0.009	0.029	3gtyX.pdb.gz
17	PDB:7ungC4	0.052	0.191	7.556	219	0.011	0.068	7ungC4.pdb.gz	SPACA9 is a lumenal protein of human ciliary singlet and doublet microtubules.
18	PDB:6ltjI	0.035	0.083	8.703	551	0.027	0.069	6ltjI.pdb.gz	Structure of nucleosome-bound human BAF complex.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9NXG0	0.0	2845	1405	1.000	1.000	CNTLN_HUMAN Centlein OS=Homo sapiens OX=9606 GN=CNTLN PE=1 SV=6
2	H3BV03	0.008	43.5	1281	0.016	0.017	H3BV03_HUMAN RPGRIP1 like OS=Homo sapiens OX=9606 GN=RPGRIP1L PE=1 SV=1
3	Q68CZ1	0.008	43.1	1315	0.016	0.017	FTM_HUMAN Protein fantom OS=Homo sapiens OX=9606 GN=RPGRIP1L PE=1 SV=2
4	D0Z5P0	0.22	38.5	1328	0.019	0.020	D0Z5P0_CAEEL GRIP domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=sql-1 PE=1 SV=1
5	Q9VGE4	0.43	37.7	1135	0.019	0.023	Q9VGE4_DROME FI04457p OS=Drosophila melanogaster OX=7227 GN=GCC185 PE=1 SV=3
6	A0A2C9C2L6	0.74	36.6	624	0.072	0.162	A0A2C9C2L6_CAEEL Intraflagellar transport protein 74 homolog OS=Caenorhabditis elegans OX=6239 GN=ift-74 PE=4 SV=1
7	R4GDZ5	0.87	36.6	1938	0.029	0.021	R4GDZ5_DANRE Myosin, heavy chain 7B, cardiac muscle, beta a OS=Danio rerio OX=7955 GN=myh7b PE=1 SV=3
8	Q3UKC1	0.91	36.6	814	0.040	0.069	TAXB1_MOUSE Tax1-binding protein 1 homolog OS=Mus musculus OX=10090 GN=Tax1bp1 PE=1 SV=2
9	B2RWW2	1.8	35.8	3238	0.028	0.012	B2RWW2_MOUSE Golgb1 protein OS=Mus musculus OX=10090 GN=Golgb1 PE=2 SV=1
10	E9PVZ8	1.8	35.8	3238	0.028	0.012	E9PVZ8_MOUSE Golgi autoantigen, golgin subfamily b, macrogolgin 1 OS=Mus musculus OX=10090 GN=Golgb1 PE=1 SV=1
11	E9QAH1	1.9	35.4	3197	0.028	0.012	E9QAH1_MOUSE Golgi autoantigen, golgin subfamily b, macrogolgin 1 OS=Mus musculus OX=10090 GN=Golgb1 PE=1 SV=1
12	P11055	3.4	34.7	1940	0.026	0.019	MYH3_HUMAN Myosin-3 OS=Homo sapiens OX=9606 GN=MYH3 PE=1 SV=3
13	P13541	3.5	34.7	1940	0.026	0.019	MYH3_MOUSE Myosin-3 OS=Mus musculus OX=10090 GN=Myh3 PE=2 SV=2
14	A7E2Y1	4.2	34.3	1983	0.035	0.025	MYH7B_HUMAN Myosin-7B OS=Homo sapiens OX=9606 GN=MYH7B PE=1 SV=4
15	A0A087X1B1	5.4	33.5	418	0.023	0.077	A0A087X1B1_HUMAN Inhibitor of nuclear factor kappa B kinase regulatory subunit gamma OS=Homo sapiens OX=9606 GN=IKBKG PE=1 SV=1
16	A0A087X0G7	5.8	33.5	411	0.023	0.078	A0A087X0G7_HUMAN Inhibitor of nuclear factor kappa B kinase regulatory subunit gamma OS=Homo sapiens OX=9606 GN=IKBKG PE=1 SV=1
17	Q5B0N1	5.8	33.9	1179	0.024	0.029	Q5B0N1_EMENI Chromosome segregation protein sudA OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_05899 PE=3 SV=1
18	A2AQP0	6.0	33.9	1941	0.035	0.025	MYH7B_MOUSE Myosin-7B OS=Mus musculus OX=10090 GN=Myh7b PE=3 SV=1
19	P12883	6.2	33.9	1935	0.029	0.021	MYH7_HUMAN Myosin-7 OS=Homo sapiens OX=9606 GN=MYH7 PE=1 SV=5
20	O45935	7.1	33.5	1083	0.021	0.027	KLP19_CAEEL Kinesin-like protein klp-19 OS=Caenorhabditis elegans OX=6239 GN=klp-19 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000370021

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000352572	0.932	Pericentrin
2	9606.ENSP00000418960	0.853	Breast cancer type 1 susceptibility protein
3	9606.ENSP00000343818	0.824	CDK5 regulatory subunit-associated protein 2
4	9606.ENSP00000355966	0.824	Serine/threonine-protein kinase Nek2
5	9606.ENSP00000306760	0.794	Leucine-rich repeat-containing protein 45
6	9606.ENSP00000380661	0.794	Centrosome-associated protein CEP250
7	9606.ENSP00000359300	0.775	Centrin-2
8	9606.ENSP00000245544	0.764	Nuclear pore complex protein Nup85
9	9606.ENSP00000355500	0.764	Centrosomal protein of 170 kDa
10	9606.ENSP00000448012	0.763	Centrosomal protein of 290 kDa
11	9606.ENSP00000364691	0.754	Rootletin
12	9606.ENSP00000371472	0.748	Ninein
13	9606.ENSP00000356579	0.738	Centrosome-associated protein 350
14	9606.ENSP00000251413	0.725	Tubulin gamma-1 chain
15	9606.ENSP00000270861	0.725	Serine/threonine-protein kinase PLK4
16	9606.ENSP00000360540	0.724	Centrosomal protein of 55 kDa
17	9606.ENSP00000313752	0.716	SS nuclear autoantigen 1
18	9606.ENSP00000370803	0.709	Centriolar coiled-coil protein of 110 kDa
19	9606.ENSP00000393312	0.707	Fibroblast growth factor receptor 1
20	9606.ENSP00000251968	0.700	Tumor susceptibility gene 101 protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0030674	1.000	protein-macromolecule adaptor activity
GO:0019904	1.000	protein domain specific binding
GO:0019901	1.000	protein kinase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0031023	0.985	microtubule organizing center organization
GO:0007098	0.977	centrosome cycle
GO:0051179	0.958	localization
GO:0051641	0.938	cellular localization
GO:0033036	0.854	macromolecule localization
GO:0070727	0.779	cellular macromolecule localization
GO:0008104	0.767	protein localization
GO:0065007	0.665	biological regulation
GO:0050794	0.663	regulation of cellular process
GO:0033365	0.511	protein localization to organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0005813	0.999	centrosome
GO:0005654	0.999	nucleoplasm
GO:0005814	0.997	centriole
GO:0005576	0.996	extracellular region
GO:0070062	0.991	extracellular exosome
GO:0012505	0.534	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]