StarFunc result for job id Q9NXH3

User Input

>input (145 residues)
MLSSSPASCTSPSPDGENPCKKVHWASGRRRTSSTDSESKSHPDSSKIPRSRRPSRLTVK
YDRGQLQRWLEMEQWVDAQVQELFQDQATPSEPEIDLEALMDLSTEEQKTQLEAILGNCP
RPTEAFISELLSQLKKLRRLSRPQK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9NXH3	1.000	1.000	3.189E-21	145	1.000	1.000	Q9NXH3.pdb.gz	PP14D_HUMAN Protein phosphatase 1 regulatory subunit 14D OS=Homo sapiens OX=9606 GN=PPP1R14D PE=1 SV=1
2	AFDB:Q8K3F3	0.562	0.556	2.921E-7	147	0.317	0.313	Q8K3F3.pdb.gz	PP14B_RAT Protein phosphatase 1 regulatory subunit 14B OS=Rattus norvegicus OX=10116 GN=Ppp1r14b PE=2 SV=1
3	AFDB:Q8R4R9	0.483	0.433	2.921E-7	164	0.303	0.268	Q8R4R9.pdb.gz	PP14C_RAT Protein phosphatase 1 regulatory subunit 14C OS=Rattus norvegicus OX=10116 GN=Ppp1r14c PE=1 SV=1
4	AFDB:Q14BX6	0.590	0.562	3.097E-7	153	0.297	0.281	Q14BX6.pdb.gz	Q14BX6_MOUSE Protein phosphatase 1 regulatory subunit 14 OS=Mus musculus OX=10090 GN=Ppp1r14bl PE=1 SV=1
5	AFDB:O18734	0.471	0.466	2.482E-5	147	0.290	0.286	O18734.pdb.gz	PP14A_PIG Protein phosphatase 1 regulatory subunit 14A OS=Sus scrofa OX=9823 GN=CPI17 PE=1 SV=1
6	AFDB:F4HTC2	0.153	0.051	3.033E-1	601	0.172	0.042	F4HTC2.pdb.gz	F4HTC2_ARATH O-fucosyltransferase family protein OS=Arabidopsis thaliana OX=3702 GN=At1g53770 PE=1 SV=1
7	AFDB:Q9LV85	0.176	0.067	5.132E-1	564	0.179	0.046	Q9LV85.pdb.gz	CPR5_ARATH Protein CPR-5 OS=Arabidopsis thaliana OX=3702 GN=CPR5 PE=1 SV=1
8	AFDB:Q5VQK9	0.169	0.111	6.874E-1	292	0.186	0.092	Q5VQK9.pdb.gz	CEST_ORYSJ Protein CHLOROPLAST ENHANCING STRESS TOLERANCE, chloroplastic OS=Oryza sativa subsp. japonica OX=39947 GN=CEST PE=2 SV=1
9	AFDB:Q8VIH1	0.155	0.054	8.192E-1	527	0.124	0.034	Q8VIH1.pdb.gz	NOBOX_MOUSE Homeobox protein NOBOX OS=Mus musculus OX=10090 GN=Nobox PE=1 SV=1
10	AFDB:V5RGX6	0.201	0.082	8.685E-1	465	0.172	0.054	V5RGX6.pdb.gz	V5RGX6_9STRA Aureochrome 1 OS=Nannochloropsis gaditana OX=72520 GN=AUREO1 PE=2 SV=1
11	PDB:6jbjA	0.152	0.049	1.714	565	0.131	0.034	6jbjA.pdb.gz	Cryo-EM structure of human lysosomal cobalamin exporter ABCD4.
12	PDB:5jxdA	0.225	0.185	2.434	186	0.083	0.065	5jxdA.pdb.gz	The Tnfaip8-PE complex is a novel upstream effector in the anti-autophagic action of insulin
13	PDB:3ay5A	0.182	0.099	2.581	298	0.069	0.034	3ay5A.pdb.gz
14	PDB:4g9bA	0.245	0.173	2.736	227	0.090	0.057	4g9bA.pdb.gz	Crystal structure of beta-phosphoglucomutase homolog from escherichia coli, target efi-501172, with bound mg, open lid
15	PDB:3qj9A	0.188	0.071	2.901	549	0.103	0.027	3qj9A.pdb.gz	Discovery and molecular basis of potent noncovalent inhibitors of fatty acid amide hydrolase (FAAH).
16	PDB:7z0lB	0.255	0.119	2.901	370	0.117	0.046	7z0lB.pdb.gz
17	PDB:5ganG	0.174	0.082	3.075	318	0.083	0.038	5ganG.pdb.gz	Cryo-EM structure of the yeast U4/U6.U5 tri-snRNP at 3.7 angstrom resolution.
18	PDB:5t5wC	0.222	0.215	3.075	151	0.110	0.106	5t5wC.pdb.gz
19	PDB:7s4vA	0.252	0.049	3.075	1122	0.138	0.018	7s4vA.pdb.gz	Structural basis for mismatch surveillance by CRISPR-Cas9.
20	PDB:5bpwA	0.148	0.042	4.119	659	0.083	0.018	5bpwA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9NXH3	4.93e-103	292	145	1.000	1.000	PP14D_HUMAN Protein phosphatase 1 regulatory subunit 14D OS=Homo sapiens OX=9606 GN=PPP1R14D PE=1 SV=1
2	Q8K3F3	2.74e-17	75.1	147	0.262	0.259	PP14B_RAT Protein phosphatase 1 regulatory subunit 14B OS=Rattus norvegicus OX=10116 GN=Ppp1r14b PE=2 SV=1
3	Q14BX6	1.79e-16	73.2	153	0.290	0.275	Q14BX6_MOUSE Protein phosphatase 1 regulatory subunit 14 OS=Mus musculus OX=10090 GN=Ppp1r14bl PE=1 SV=1
4	Q8R4S0	2.49e-16	73.2	164	0.262	0.232	PP14C_MOUSE Protein phosphatase 1 regulatory subunit 14C OS=Mus musculus OX=10090 GN=Ppp1r14c PE=1 SV=1
5	Q96A00	1.27e-14	68.6	147	0.290	0.286	PP14A_HUMAN Protein phosphatase 1 regulatory subunit 14A OS=Homo sapiens OX=9606 GN=PPP1R14A PE=1 SV=1
6	O18734	6.56e-14	66.6	147	0.303	0.299	PP14A_PIG Protein phosphatase 1 regulatory subunit 14A OS=Sus scrofa OX=9823 GN=CPI17 PE=1 SV=1
7	Q91VC7	2.09e-13	65.1	147	0.276	0.272	PP14A_MOUSE Protein phosphatase 1 regulatory subunit 14A OS=Mus musculus OX=10090 GN=Ppp1r14a PE=1 SV=1
8	Q99MC0	3.78e-13	64.7	147	0.276	0.272	PP14A_RAT Protein phosphatase 1 regulatory subunit 14A OS=Rattus norvegicus OX=10116 GN=Ppp1r14a PE=1 SV=1
9	Q8R4R9	5.36e-13	64.7	164	0.241	0.213	PP14C_RAT Protein phosphatase 1 regulatory subunit 14C OS=Rattus norvegicus OX=10116 GN=Ppp1r14c PE=1 SV=1
10	Q9QZW9	1.1	31.2	404	0.166	0.059	MNX1_MOUSE Motor neuron and pancreas homeobox protein 1 OS=Mus musculus OX=10090 GN=Mnx1 PE=1 SV=2
11	M0R6D8	1.5	30.8	403	0.179	0.065	MNX1_RAT Motor neuron and pancreas homeobox 1 OS=Rattus norvegicus OX=10116 GN=Mnx1 PE=3 SV=2
12	Q9LU73	2.1	30.8	1028	0.110	0.016	SMXL5_ARATH Protein SMAX1-LIKE 5 OS=Arabidopsis thaliana OX=3702 GN=SMXL5 PE=2 SV=1
13	O48832	2.2	30.4	452	0.117	0.038	ERD7_ARATH Protein EARLY-RESPONSIVE TO DEHYDRATION 7, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=ERD7 PE=1 SV=1
14	G8BJ60	2.7	30.4	2392	0.138	0.008	G8BJ60_CANPC Agglutinin-like protein N-terminal domain-containing protein OS=Candida parapsilosis (strain CDC 317 / ATCC MYA-4646) OX=578454 GN=ALS6 PE=3 SV=1
15	Q6NXT6	2.7	30.4	567	0.110	0.028	TAPT1_HUMAN Transmembrane anterior posterior transformation protein 1 homolog OS=Homo sapiens OX=9606 GN=TAPT1 PE=1 SV=1
16	P50219	3.1	30.0	401	0.152	0.055	MNX1_HUMAN Motor neuron and pancreas homeobox protein 1 OS=Homo sapiens OX=9606 GN=MNX1 PE=1 SV=3
17	A8WG95	4.5	29.6	554	0.166	0.043	A8WG95_DANRE Membrane-associated transporter protein OS=Danio rerio OX=7955 GN=aim1 PE=2 SV=1
18	F1RCJ6	4.5	29.3	328	0.166	0.073	F1RCJ6_DANRE Motor neuron and pancreas homeobox 2b OS=Danio rerio OX=7955 GN=hlxb9lb PE=4 SV=1
19	O44820	5.6	28.9	197	0.124	0.091	O44820_CAEEL Ubiquitin-like domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=CELE_F52C6.3 PE=1 SV=2
20	Q9VSC2	9.3	28.5	525	0.117	0.032	Q9VSC2_DROME Extra-extra OS=Drosophila melanogaster OX=7227 GN=exex PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03040 CemA	2.2e+02	13.2	CemA family
2	PF20419 DUF6701	4.4e+02	11.3	Family of unknown function (DUF6701)
3	PF05361 PP1_inhibitor	3.3e-20	84.1	PKC-activated protein phosphatase-1 inhibitor

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 60711.ENSCSAP00000003848

Rank	PPI partner	STRING score	Description
1	60711.ENSCSAP00000003660	0.550	Functions in nuclear protein import.
2	60711.ENSCSAP00000017797	0.523	Protease, serine, 35

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004865	1.000	protein serine/threonine phosphatase inhibitor activity
GO:0005488	0.383	binding
GO:0005515	0.374	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.968	regulation of cellular process
GO:0031323	0.925	regulation of cellular metabolic process
GO:0019220	0.902	regulation of phosphate metabolic process
GO:0035306	0.799	positive regulation of dephosphorylation
GO:0035305	0.799	negative regulation of dephosphorylation
GO:0043666	0.799	regulation of phosphoprotein phosphatase activity
GO:0035307	0.699	positive regulation of protein dephosphorylation
GO:0031400	0.686	negative regulation of protein modification process
GO:0035308	0.684	negative regulation of protein dephosphorylation
GO:0051346	0.677	negative regulation of hydrolase activity
GO:0010923	0.643	negative regulation of phosphatase activity
GO:0010922	0.643	positive regulation of phosphatase activity
GO:0050896	0.439	response to stimulus
GO:0009987	0.422	cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.998	cytoplasm
GO:0005829	0.915	cytosol
GO:0043231	0.874	intracellular membrane-bounded organelle
GO:0016020	0.840	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]