StarFunc result for job id Q9NXH9

User Input

>input (659 residues)
MQGSSLWLSLTFRSARVLSRARFFEWQSPGLPNTAAMENGTGPYGEERPREVQETTVTEG
AAKIAFPSANEVFYNPVQEFNRDLTCAVITEFARIQLGAKGIQIKVPGEKDTQKVVVDLS
EQEEEKVELKESENLASGDQPRTAAVGEICEEGLHVLEGLAASGLRSIRFALEVPGLRSV
VANDASTRAVDLIRRNVQLNDVAHLVQPSQADARMLMYQHQRVSERFDVIDLDPYGSPAT
FLDAAVQAVSEGGLLCVTCTDMAVLAGNSGETCYSKYGAMALKSRACHEMALRIVLHSLD
LRANCYQRFVVPLLSISADFYVRVFVRVFTGQAKVKASASKQALVFQCVGCGAFHLQRLG
KASGVPSGRAKFSAACGPPVTPECEHCGQRHQLGGPMWAEPIHDLDFVGRVLEAVSANPG
RFHTSERIRGVLSVITEELPDVPLYYTLDQLSSTIHCNTPSLLQLRSALLHADFRVSLSH
ACKNAVKTDAPASALWDIMRCWEKECPVKRERLSETSPAFRILSVEPRLQANFTIREDAN
PSSRQRGLKRFQANPEANWGPRPRARPGGKAADEAMEERRRLLQNKRKEPPEDVAQRAAR
LKTFPCKRFKEGTCQRGDQCCYSHSPPTPRVSADAAPDCPETSNQTPPGPGAAAGPGID

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9NXH9	1.000	1.000	0.000	659	1.000	1.000	Q9NXH9.pdb.gz	TRM1_HUMAN tRNA (guanine(26)-N(2))-dimethyltransferase OS=Homo sapiens OX=9606 GN=TRMT1 PE=1 SV=1
2	AFDB:Q9VK89	0.712	0.809	2.376E-63	578	0.372	0.424	Q9VK89.pdb.gz	TRM1_DROME tRNA (guanine(26)-N(2))-dimethyltransferase OS=Drosophila melanogaster OX=7227 GN=Trm1 PE=1 SV=1
3	AFDB:Q9P804	0.672	0.806	3.125E-57	548	0.335	0.403	Q9P804.pdb.gz	TRM1_SCHPO tRNA (guanine(26)-N(2))-dimethyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=trm1 PE=1 SV=1
4	AFDB:Q9SRU7	0.683	0.762	3.297E-57	589	0.328	0.367	Q9SRU7.pdb.gz	TRM2_ARATH tRNA (guanine(26)-N(2))-dimethyltransferase 2 OS=Arabidopsis thaliana OX=3702 GN=At3g02320 PE=1 SV=3
5	AFDB:P15565	0.663	0.763	1.488E-49	570	0.291	0.337	P15565.pdb.gz	TRM1_YEAST tRNA (guanine(26)-N(2))-dimethyltransferase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TRM1 PE=1 SV=1
6	AFDB:Q5AQM4	0.611	0.576	9.255E-43	700	0.294	0.277	Q5AQM4.pdb.gz	Q5AQM4_EMENI An-Trm1 protein related to S. cerevisiae Trm1 (Eurofung) OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_09406 PE=3 SV=1
7	AFDB:Q386C5	0.639	0.529	2.076E-38	802	0.273	0.224	Q386C5.pdb.gz	Q386C5_TRYB2 N(2), N(2)-dimethylguanosine tRNA methyltransferase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.1390 PE=3 SV=1
8	AFDB:Q9LYL0	0.500	0.748	1.166E-26	433	0.173	0.263	Q9LYL0.pdb.gz	Q9LYL0_ARATH tRNA (guanine(26)-N(2))-dimethyltransferase OS=Arabidopsis thaliana OX=3702 GN=TRM1C PE=1 SV=1
9	AFDB:Q7Z2T5	0.501	0.453	4.005E-24	733	0.153	0.138	Q7Z2T5.pdb.gz	TRM1L_HUMAN TRMT1-like protein OS=Homo sapiens OX=9606 GN=TRMT1L PE=1 SV=2
10	AFDB:A2RSY6	0.498	0.453	1.234E-23	728	0.153	0.139	A2RSY6.pdb.gz	TRM1L_MOUSE TRMT1-like protein OS=Mus musculus OX=10090 GN=Trmt1l PE=1 SV=1
11	PDB:5yacA	0.245	0.472	2.322E-7	330	0.068	0.136	5yacA.pdb.gz
12	PDB:3c0kA	0.204	0.330	6.092E-7	395	0.058	0.096	3c0kA.pdb.gz
13	PDB:3a25A	0.238	0.559	1.290E-6	264	0.052	0.129	3a25A.pdb.gz	Structural basis of AdoMet-dependent aminocarboxypropyl transfer reaction catalyzed by tRNA-wybutosine synthesizing enzyme, TYW2
14	PDB:2zznA	0.224	0.413	3.383E-6	336	0.056	0.110	2zznA.pdb.gz	Tertiary structure checkpoint at anticodon loop modification in tRNA functional maturation.
15	PDB:3a27A	0.247	0.686	3.569E-6	219	0.061	0.183	3a27A.pdb.gz	Structural basis of AdoMet-dependent aminocarboxypropyl transfer reaction catalyzed by tRNA-wybutosine synthesizing enzyme, TYW2
16	PDB:3ay0B	0.159	0.313	4.665E-6	314	0.046	0.096	3ay0B.pdb.gz	Differentiating analogous tRNA methyltransferases by fragments of the methyl donor.
17	PDB:7of5C	0.194	0.355	4.665E-6	338	0.049	0.095	7of5C.pdb.gz	Structural basis of GTPase-mediated mitochondrial ribosome biogenesis and recycling.
18	PDB:1qzzA	0.196	0.346	5.478E-6	340	0.046	0.088	1qzzA.pdb.gz	Crystal Structure of Aclacinomycin-10-Hydroxylase, a S-Adenosyl-L-Methionine-dependent Methyltransferase Homolog Involved in Anthracycline Biosynthesis in Streptomyces purpurascens.
19	PDB:5mgzA	0.199	0.517	6.787E-6	230	0.046	0.130	5mgzA.pdb.gz	Structural and Functional Basis of C-Methylation of Coumarin Scaffolds by NovO.
20	PDB:6jclG	0.194	0.503	1.982E-5	219	0.042	0.128	6jclG.pdb.gz	Structural and biochemical characterization of Rv0187, an O-methyltransferase from Mycobacterium tuberculosis.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9NXH9	0.0	1360	659	1.000	1.000	TRM1_HUMAN tRNA (guanine(26)-N(2))-dimethyltransferase OS=Homo sapiens OX=9606 GN=TRMT1 PE=1 SV=1
2	Q9VK89	3.51e-158	469	578	0.382	0.436	TRM1_DROME tRNA (guanine(26)-N(2))-dimethyltransferase OS=Drosophila melanogaster OX=7227 GN=Trm1 PE=1 SV=1
3	Q9P804	4.65e-143	429	548	0.343	0.412	TRM1_SCHPO tRNA (guanine(26)-N(2))-dimethyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=trm1 PE=1 SV=1
4	Q9SRU7	2.33e-134	409	589	0.326	0.365	TRM2_ARATH tRNA (guanine(26)-N(2))-dimethyltransferase 2 OS=Arabidopsis thaliana OX=3702 GN=At3g02320 PE=1 SV=3
5	P15565	7.83e-110	344	570	0.310	0.358	TRM1_YEAST tRNA (guanine(26)-N(2))-dimethyltransferase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TRM1 PE=1 SV=1
6	Q5AQM4	4.08e-82	275	700	0.261	0.246	Q5AQM4_EMENI An-Trm1 protein related to S. cerevisiae Trm1 (Eurofung) OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_09406 PE=3 SV=1
7	Q386C5	3.43e-35	144	802	0.103	0.085	Q386C5_TRYB2 N(2), N(2)-dimethylguanosine tRNA methyltransferase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.1390 PE=3 SV=1
8	Q9LYL0	2.90e-26	114	433	0.167	0.254	Q9LYL0_ARATH tRNA (guanine(26)-N(2))-dimethyltransferase OS=Arabidopsis thaliana OX=3702 GN=TRM1C PE=1 SV=1
9	A2RSY6	2.84e-11	68.9	728	0.105	0.095	TRM1L_MOUSE TRMT1-like protein OS=Mus musculus OX=10090 GN=Trmt1l PE=1 SV=1
10	Q7Z2T5	5.43e-10	65.1	733	0.102	0.091	TRM1L_HUMAN TRMT1-like protein OS=Homo sapiens OX=9606 GN=TRMT1L PE=1 SV=2
11	Q58293	0.001	43.9	336	0.033	0.065	TRM5B_METJA tRNA (guanine(37)-N1)-methyltransferase Trm5b OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) OX=243232 GN=trm5b PE=1 SV=1
12	O74463	0.002	43.9	547	0.036	0.044	YQC1_SCHPO Uncharacterized protein C1739.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC1739.01 PE=1 SV=2
13	P75876	0.027	39.7	396	0.050	0.083	RLMI_ECOLI Ribosomal RNA large subunit methyltransferase I OS=Escherichia coli (strain K12) OX=83333 GN=rlmI PE=1 SV=2
14	Q57Z17	0.37	35.8	280	0.020	0.046	Q57Z17_TRYB2 C3H1-type domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb05.45E22.620 PE=3 SV=1
15	P41000	0.42	36.2	583	0.018	0.021	CPS3_SCHPO Protein cps3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=cps3 PE=1 SV=3
16	Q9LXV4	0.58	35.8	706	0.030	0.028	C3H56_ARATH Zinc finger CCCH domain-containing protein 56 OS=Arabidopsis thaliana OX=3702 GN=At5g12850 PE=2 SV=1
17	Q9LUZ4	0.62	35.8	607	0.023	0.025	C3H66_ARATH Zinc finger CCCH domain-containing protein 66 OS=Arabidopsis thaliana OX=3702 GN=At5g58620 PE=2 SV=1
18	P93755	0.80	35.4	716	0.023	0.021	C3H30_ARATH Zinc finger CCCH domain-containing protein 30 OS=Arabidopsis thaliana OX=3702 GN=At2g41900 PE=1 SV=2
19	Q22805	1.4	34.7	574	0.018	0.021	Q22805_CAEEL C3H1-type domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=CELE_T26A8.4 PE=1 SV=1
20	Q92922	1.6	34.7	1105	0.036	0.022	SMRC1_HUMAN SWI/SNF complex subunit SMARCC1 OS=Homo sapiens OX=9606 GN=SMARCC1 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03602 Cons_hypoth95	13	16.9	Conserved hypothetical protein 95
2	PF17858 Defensin_int	8.1e+02	11.4	Platypus intermediate defensin-like peptide
3	PF02475 Met_10	0.0098	27.2	Met-10+ like-protein
4	PF00935 Ribosomal_L44	1.4e+02	14.4	Ribosomal protein L44
5	PF16131 Torus	1.4	21.0	Torus domain
6	PF02005 TRM	1.5e-148	506.6	N2,N2-dimethylguanosine tRNA methyltransferase
7	PF00642 zf-CCCH	0.0011	30.1	Zinc finger C-x8-C-x5-C-x3-H type (and similar)
8	PF18345 zf_CCCH_4	2.1e+02	13.4	Zinc finger domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000466967

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000314441	0.981	tRNA (guanine-N(7)-)-methyltransferase
2	9606.ENSP00000264670	0.956	tRNA (cytosine(34)-C(5))-methyltransferase
3	9606.ENSP00000203001	0.952	tRNA (adenine(58)-N(1))-methyltransferase non-catalytic subunit TRM6
4	9606.ENSP00000333934	0.945	tRNA (guanine(10)-N2)-methyltransferase homolog
5	9606.ENSP00000232888	0.923	U3 small nucleolar RNA-interacting protein 2
6	9606.ENSP00000396673	0.923	pre-rRNA processing protein FTSJ3
7	9606.ENSP00000303584	0.915	HemK methyltransferase family member 2
8	9606.ENSP00000346725	0.914	Pescadillo homolog
9	9606.ENSP00000234170	0.912	CCAAT/enhancer-binding protein zeta
10	9606.ENSP00000360412	0.910	Nucleolar complex protein 3 homolog
11	9606.ENSP00000483495	0.909	Probable ATP-dependent RNA helicase DDX27
12	9606.ENSP00000371858	0.903	Probable 28S rRNA (cytosine(4447)-C(5))-methyltransferase
13	9606.ENSP00000326948	0.900	Putative tRNA (cytidine(32)/guanosine(34)-2'-O)-methyltransferase
14	9606.ENSP00000273962	0.893	tRNA methyltransferase 10 homolog A
15	9606.ENSP00000257829	0.891	RNA cytidine acetyltransferase
16	9606.ENSP00000348596	0.887	Protein SDA1 homolog
17	9606.ENSP00000223073	0.883	RNA-binding protein 28
18	9606.ENSP00000040877	0.879	Probable methyltransferase TARBP1
19	9606.ENSP00000227474	0.877	tRNA pseudouridine(38/39) synthase
20	9606.ENSP00000361704	0.876	CTP synthase 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003723	1.000	RNA binding
GO:0004809	1.000	tRNA (guanine-N2-)-methyltransferase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.998	organic substance metabolic process
GO:0044238	0.997	primary metabolic process
GO:0044237	0.997	cellular metabolic process
GO:0016070	0.987	RNA metabolic process
GO:0010467	0.981	gene expression
GO:0034470	0.964	ncRNA processing
GO:0006399	0.950	tRNA metabolic process
GO:0008033	0.944	tRNA processing
GO:0006400	0.906	tRNA modification

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.999	nucleoplasm
GO:0043232	0.929	intracellular non-membrane-bounded organelle
GO:0005737	0.865	cytoplasm
GO:0005829	0.392	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.1.1.-	1.000	Methyltransferases.

[back to server]