StarFunc result for job id Q9NXL2

User Input

>input (777 residues)
MEPKEATGKENMVTKKKNLAFLRSRLYMLERRKTDTVVESSVSGDHSGTLRRSQSDRTEY
NQKLQEKMTPQGECSVAETLTPEEEHHMKRMMAKREKIIKELIQTEKDYLNDLELCVREV
VQPLRNKKTDRLDVDSLFSNIESVHQISAKLLSLLEEATTDVEPAMQVIGEVFLQIKGPL
EDIYKIYCYHHDEAHSILESYEKEEELKEHLSHCIQSLKKIYMQEGKPNLLDMGSLMIKP
IQRVMKYPLLLCELRNSTPPSHPDYRALDDAFAAVKDINVNINELKRRKDLVLKYKKNDE
DESLKDKLSKLNIHSISKKSKRVTNHLKILTRGESQVKDNTFNREEKLFRALEKTVRLCV
KNISLCLQHIQDAMPLALQSVMDLQEISYNKDDEMDYSETLSNALNSCHDFASHLQRLIL
TPLSALLSLFPGPHKLIQKRYDKLLDCNSYLQRSTGEESDLAKKEYEALNAQLVEELQAF
NQAARKILLNCLCSFITLLRDLMLVAQQAYSTLVPMPLLVSSISEIQNQVLEEIQNLNCV
KENSATFIERKLSFEKKKPVQILPEMPHQTDIHRSKLLSTYSAEELYQAKRKCNATQEYD
INLLEGDLVAVIEQKDPLGSTSRWLVDTGNVKGYVYSSFLKPYNPAKMQKVDAENRFCDD
DFENISLFVSSRPASDSVTGTSESSIGDSSSSLSGTCGKFETNGTDVDSFQEVDEQIFYA
VHAFQARSDHELSLQEYQRVHILRFCDLSGNKEWWLAEAQGQKGYVPANYLGKMTYA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9NXL2	1.000	1.000	1.735E-103	777	1.000	1.000	Q9NXL2.pdb.gz	ARH38_HUMAN Rho guanine nucleotide exchange factor 38 OS=Homo sapiens OX=9606 GN=ARHGEF38 PE=1 SV=2
2	AFDB:E7F1U2	0.550	0.275	4.784E-47	1673	0.417	0.194	E7F1U2.pdb.gz	DNMBP_DANRE Dynamin-binding protein OS=Danio rerio OX=7955 GN=dnmbp PE=2 SV=1
3	AFDB:E2RP94	0.522	0.276	3.767E-46	1583	0.394	0.193	E2RP94.pdb.gz	DNMBP_CANLF Dynamin-binding protein OS=Canis lupus familiaris OX=9615 GN=DNMBP PE=3 SV=2
4	AFDB:Q6XZF7	0.548	0.287	8.076E-46	1577	0.391	0.193	Q6XZF7.pdb.gz	DNMBP_HUMAN Dynamin-binding protein OS=Homo sapiens OX=9606 GN=DNMBP PE=1 SV=1
5	AFDB:M0R4F8	0.532	0.284	3.393E-45	1577	0.380	0.187	M0R4F8.pdb.gz	DNMBP_RAT Dynamin-binding protein OS=Rattus norvegicus OX=10116 GN=Dnmbp PE=1 SV=2
6	AFDB:Q6TXD4	0.543	0.291	9.104E-45	1580	0.387	0.191	Q6TXD4.pdb.gz	DNMBP_MOUSE Dynamin-binding protein OS=Mus musculus OX=10090 GN=Dnmbp PE=1 SV=2
7	AFDB:G5ECK4	0.409	0.226	7.538E-20	1523	0.224	0.114	G5ECK4.pdb.gz	G5ECK4_CAEEL SH3 domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=dnbp-1 PE=1 SV=1
8	AFDB:O59679	0.388	0.536	3.315E-16	525	0.130	0.192	O59679.pdb.gz	GEF3_SCHPO Rho guanine nucleotide exchange factor gef3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gef3 PE=4 SV=1
9	AFDB:Q09763	0.241	0.248	9.592E-12	753	0.142	0.146	Q09763.pdb.gz	GEF1_SCHPO Rho guanine nucleotide exchange factor gef1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gef1 PE=1 SV=1
10	AFDB:Q9TW28	0.242	0.110	1.880E-11	1737	0.115	0.051	Q9TW28.pdb.gz	MYOM_DICDI Myosin-M heavy chain OS=Dictyostelium discoideum OX=44689 GN=myoM PE=1 SV=1
11	PDB:7rx9A	0.232	0.410	5.574E-9	432	0.081	0.146	7rx9A.pdb.gz
12	PDB:4mt6A	0.232	0.452	4.731E-7	389	0.067	0.134	4mt6A.pdb.gz
13	PDB:2lqnA	0.074	0.177	8.230E-5	303	0.030	0.076	2lqnA.pdb.gz
14	PDB:1griA	0.074	0.263	8.482E-4	211	0.044	0.161	1griA.pdb.gz
15	PDB:3qwyA	0.070	0.312	1.520E-3	170	0.021	0.094	3qwyA.pdb.gz
16	PDB:3ehqA	0.069	0.282	1.662E-3	182	0.021	0.088	3ehqA.pdb.gz
17	PDB:2eyzA	0.078	0.177	1.818E-3	304	0.039	0.099	2eyzA.pdb.gz
18	PDB:1k9aB	0.071	0.124	4.264E-3	441	0.017	0.029	1k9aB.pdb.gz
19	PDB:4gouA	0.207	0.307	4.879E-3	507	0.060	0.093	4gouA.pdb.gz
20	PDB:1k0xA	0.073	0.489	8.741E-3	108	0.014	0.102	1k0xA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9NXL2	0.0	1605	777	1.000	1.000	ARH38_HUMAN Rho guanine nucleotide exchange factor 38 OS=Homo sapiens OX=9606 GN=ARHGEF38 PE=1 SV=2
2	E7F1U2	1.04e-152	488	1673	0.337	0.157	DNMBP_DANRE Dynamin-binding protein OS=Danio rerio OX=7955 GN=dnmbp PE=2 SV=1
3	Q6XZF7	4.30e-140	452	1577	0.326	0.160	DNMBP_HUMAN Dynamin-binding protein OS=Homo sapiens OX=9606 GN=DNMBP PE=1 SV=1
4	E2RP94	1.07e-138	448	1583	0.329	0.162	DNMBP_CANLF Dynamin-binding protein OS=Canis lupus familiaris OX=9615 GN=DNMBP PE=3 SV=2
5	M0R4F8	2.18e-133	434	1577	0.318	0.157	DNMBP_RAT Dynamin-binding protein OS=Rattus norvegicus OX=10116 GN=Dnmbp PE=1 SV=2
6	Q6TXD4	3.55e-131	428	1580	0.319	0.157	DNMBP_MOUSE Dynamin-binding protein OS=Mus musculus OX=10090 GN=Dnmbp PE=1 SV=2
7	G5ECK4	2.14e-25	115	1523	0.143	0.073	G5ECK4_CAEEL SH3 domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=dnbp-1 PE=1 SV=1
8	Q9TW28	1.49e-24	112	1737	0.099	0.044	MYOM_DICDI Myosin-M heavy chain OS=Dictyostelium discoideum OX=44689 GN=myoM PE=1 SV=1
9	Q3LAC4	1.44e-20	100	1598	0.086	0.042	PREX2_MOUSE Phosphatidylinositol 3,4,5-trisphosphate-dependent Rac exchanger 2 protein OS=Mus musculus OX=10090 GN=Prex2 PE=1 SV=2
10	Q70Z35	1.58e-20	100	1606	0.084	0.040	PREX2_HUMAN Phosphatidylinositol 3,4,5-trisphosphate-dependent Rac exchanger 2 protein OS=Homo sapiens OX=9606 GN=PREX2 PE=1 SV=1
11	F1R6J2	2.61e-20	99.4	1622	0.089	0.043	F1R6J2_DANRE Phosphatidylinositol 3,4,5-trisphosphate-dependent Rac exchanger 1 protein OS=Danio rerio OX=7955 GN=prex1 PE=1 SV=1
12	A0A8I6GLR6	4.03e-20	98.6	1646	0.082	0.039	A0A8I6GLR6_RAT Phosphatidylinositol-3,4,5-trisphosphate-dependent Rac exchange factor 1 OS=Rattus norvegicus OX=10116 GN=Prex1 PE=4 SV=1
13	D3ZS72	4.16e-20	98.6	1635	0.082	0.039	D3ZS72_RAT Phosphatidylinositol-3,4,5-trisphosphate-dependent Rac exchange factor 1 OS=Rattus norvegicus OX=10116 GN=Prex1 PE=1 SV=4
14	Q69ZK0	1.38e-19	97.1	1650	0.081	0.038	PREX1_MOUSE Phosphatidylinositol 3,4,5-trisphosphate-dependent Rac exchanger 1 protein OS=Mus musculus OX=10090 GN=Prex1 PE=1 SV=2
15	Q8TCU6	8.48e-19	94.4	1659	0.080	0.037	PREX1_HUMAN Phosphatidylinositol 3,4,5-trisphosphate-dependent Rac exchanger 1 protein OS=Homo sapiens OX=9606 GN=PREX1 PE=1 SV=3
16	Q54YZ6	4.55e-18	91.7	1218	0.077	0.049	Q54YZ6_DICDI Uncharacterized protein OS=Dictyostelium discoideum OX=44689 GN=gxcA PE=4 SV=1
17	Q54BY9	6.09e-15	81.3	667	0.080	0.093	Q54BY9_DICDI Uncharacterized protein OS=Dictyostelium discoideum OX=44689 GN=gxcKK PE=4 SV=1
18	A0A024RDM6	6.60e-15	80.9	652	0.086	0.103	A0A024RDM6_HUMAN SPATA13 (Fragment) OS=Homo sapiens OX=9606 GN=SPATA13 PE=4 SV=1
19	Q96N96	6.60e-15	80.9	652	0.086	0.103	SPT13_HUMAN Spermatogenesis-associated protein 13 OS=Homo sapiens OX=9606 GN=SPATA13 PE=1 SV=1
20	Q5PRA8	7.86e-15	80.9	799	0.071	0.069	Q5PRA8_DANRE Arhgef7b protein OS=Danio rerio OX=7955 GN=arhgef7 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01724 DUF29	3.7e+02	12.7	Domain of unknown function DUF29
2	PF00621 RhoGEF	6e-36	135.9	RhoGEF domain
3	PF00018 SH3_1	0.0002	32.2	SH3 domain
4	PF07653 SH3_2	4.3e-09	47.4	Variant SH3 domain
5	PF08239 SH3_3	5.1e+02	12.5	Bacterial SH3 domain
6	PF14604 SH3_9	3.9e-06	38.0	Variant SH3 domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000416125

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000415433	0.660	Integrator complex subunit 12
2	9606.ENSP00000359607	0.592	Pyridine nucleotide-disulfide oxidoreductase domain-containing protein 2
3	9606.ENSP00000270747	0.567	Rho guanine nucleotide exchange factor 19
4	9606.ENSP00000422354	0.564	Glutathione S-transferase C-terminal domain containing
5	9606.ENSP00000367629	0.545	Rho guanine nucleotide exchange factor 16
6	9606.ENSP00000471635	0.539	Uncharacterized protein
7	9606.ENSP00000266037	0.527	Dedicator of cytokinesis protein 3
8	9606.ENSP00000367355	0.525	Rho guanine nucleotide exchange factor 35
9	9606.ENSP00000329210	0.518	Olfactory receptor 2T10
10	9606.ENSP00000283426	0.516	Pleckstrin homology and RhoGEF domain containing G4B
11	9606.ENSP00000353343	0.509	Olfactory receptor 52M1
12	9606.ENSP00000419199	0.507	Ankyrin repeat and SOCS box protein 14
13	9606.ENSP00000352097	0.505	Serine palmitoyltransferase small subunit B

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0098772	0.948	molecular function regulator activity
GO:0030695	0.940	GTPase regulator activity
GO:0005085	0.933	guanyl-nucleotide exchange factor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.989	cellular process
GO:0050794	0.988	regulation of cellular process
GO:0048583	0.897	regulation of response to stimulus
GO:0050896	0.856	response to stimulus
GO:0051716	0.797	cellular response to stimulus
GO:0007154	0.752	cell communication
GO:0007165	0.713	signal transduction
GO:0065009	0.690	regulation of molecular function
GO:0051056	0.561	regulation of small GTPase mediated signal transduction
GO:0048518	0.448	positive regulation of biological process
GO:0071840	0.323	cellular component organization or biogenesis
GO:0048522	0.300	positive regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0071944	0.791	cell periphery
GO:0043226	0.702	organelle
GO:0005886	0.523	plasma membrane
GO:0043229	0.314	intracellular organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]