StarFunc result for job id Q9NXL9

User Input

>input (1143 residues)
MNSDQVTLVGQVFESYVSEYHKNDILLILKERDEDAHYPVVVNAMTLFETNMEIGEYFNM
FPSEVLTIFDSALRRSALTILQSLSQPEAVSMKQNLHARISGLPVCPELVREHIPKTKDV
GHFLSVTGTVIRTSLVKVLEFERDYMCNKCKHVFVIKADFEQYYTFCRPSSCPSLESCDS
SKFTCLSGLSSSPTRCRDYQEIKIQEQVQRLSVGSIPRSMKVILEDDLVDSCKSGDDLTI
YGIVMQRWKPFQQDVRCEVEIVLKANYIQVNNEQSSGIIMDEEVQKEFEDFWEYYKSDPF
AGRNVILASLCPQVFGMYLVKLAVAMVLAGGIQRTDATGTRVRGESHLLLVGDPGTGKSQ
FLKYAAKITPRSVLTTGIGSTSAGLTVTAVKDSGEWNLEAGALVLADAGLCCIDEFNSLK
EHDRTSIHEAMEQQTISVAKAGLVCKLNTRTTILAATNPKGQYDPQESVSVNIALGSPLL
SRFDLILVLLDTKNEDWDRIISSFILENKGYPSKSEKLWSMEKMKTYFCLIRNLQPTLSD
VGNQVLLRYYQMQRQSDCRNAARTTIRLLESLIRLAEAHARLMFRDTVTLEDAITVVSVM
ESSMQGGALLGGVNALHTSFPENPGEQYQRQCELILEKLELQSLLSEELRRLERLQNQSV
HQSQPRVLEVETTPGSLRNGPGEESNFRTSSQQEINYSTHIFSPGGSPEGSPVLDPPPHL
EPNRSTSRKHSAQHKNNRDDSLDWFDFMATHQSEPKNTVVVSPHPKTSGENMASKISNST
SQGKEKSEPGQRSKVDIGLLPSPGETGVPWRADNVESNKKKRLALDSEAAVSADKPDSVL
THHVPRNLQKLCKERAQKLCRNSTRVPAQCTVPSHPQSTPVHSPDRMLDSPKRKRPKSLA
QVEEPAIENVKPPGSPVAKLAKFTFKQKSKLIHSFEDHSHVSPGATKIAVHSPKISQRRT
RRDAALPVKRPGKLTSTPGNQISSQPQGETKEVSQQPPEKHGPREKVMCAPEKRIIQPEL
ELGNETGCAHLTCEGDKKEEVSGSNKSGKVHACTLARLANFCFTPPSESKSKSPPPERKN
RGERGPSSPPTTTAPMRVSKRKSFQLRGSTEKLIVSKESLFTLPELGDEAFDCDWDEEMR
KKS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:I0IUP4	0.602	0.589	0.000	1169	0.581	0.568	I0IUP4.pdb.gz	MCM9_CHICK DNA helicase MCM9 OS=Gallus gallus OX=9031 GN=MCM9 PE=1 SV=2
2	AFDB:Q2KHI9	0.614	0.618	0.000	1134	0.744	0.750	Q2KHI9.pdb.gz	MCM9_MOUSE DNA helicase MCM9 OS=Mus musculus OX=10090 GN=Mcm9 PE=1 SV=2
3	AFDB:Q9NXL9	0.999	0.999	0.000	1143	1.000	1.000	Q9NXL9.pdb.gz	MCM9_HUMAN DNA helicase MCM9 OS=Homo sapiens OX=9606 GN=MCM9 PE=1 SV=4
4	PDB:7v3u6	0.407	0.672	8.216E-47	646	0.160	0.283	7v3u6.pdb.gz	Structural Insight into the MCM double hexamer activation by Dbf4-Cdc7 kinase.
5	PDB:7pmk5	0.407	0.641	3.747E-46	673	0.165	0.281	7pmk5.pdb.gz	A conserved mechanism for regulating replisome disassembly in eukaryotes.
6	PDB:7plo3	0.418	0.715	5.404E-46	628	0.156	0.283	7plo3.pdb.gz	A conserved mechanism for regulating replisome disassembly in eukaryotes.
7	PDB:7pt63	0.386	0.635	1.067E-45	637	0.149	0.267	7pt63.pdb.gz	The structural basis of Cdc7-Dbf4 kinase dependent targeting and phosphorylation of the MCM2-7 double hexamer.
8	PDB:7plo5	0.405	0.691	1.622E-45	614	0.149	0.277	7plo5.pdb.gz	A conserved mechanism for regulating replisome disassembly in eukaryotes.
9	PDB:7pfo2	0.388	0.578	3.039E-45	703	0.178	0.290	7pfo2.pdb.gz	Structure of a human replisome shows the organisation and interactions of a DNA replication machine.
10	PDB:6skl3	0.424	0.742	3.373E-44	616	0.147	0.273	6skl3.pdb.gz	Cryo-EM Structure of the Fork Protection Complex Bound to CMG at a Replication Fork.
11	PDB:7v3u7	0.396	0.608	5.402E-44	699	0.152	0.249	7v3u7.pdb.gz	Structural Insight into the MCM double hexamer activation by Dbf4-Cdc7 kinase.
12	PDB:6xtx6	0.442	0.709	7.394E-44	679	0.166	0.280	6xtx6.pdb.gz	CryoEM structures of human CMG-ATP gamma S-DNA and CMG-AND-1 complexes.
13	PDB:6skl2	0.392	0.614	1.896E-43	669	0.160	0.274	6skl2.pdb.gz	Cryo-EM Structure of the Fork Protection Complex Bound to CMG at a Replication Fork.
14	AFDB:Q6DFV5	0.109	0.070	2.415E-2	1964	0.136	0.079	Q6DFV5.pdb.gz	HELZ_MOUSE Probable helicase with zinc finger domain OS=Mus musculus OX=10090 GN=Helz PE=1 SV=2
15	AFDB:A0A0S3NTN0	0.036	0.050	4.295E-2	784	0.087	0.126	A0A0S3NTN0.pdb.gz
16	AFDB:Q7JVP4	0.046	0.039	1.959E-1	1430	0.076	0.061	Q7JVP4.pdb.gz	BRDH_DROME Bromodomain-containing protein homolog OS=Drosophila melanogaster OX=7227 GN=Br140 PE=1 SV=1
17	AFDB:Q86CW5	0.046	0.039	1.959E-1	1413	0.077	0.062	Q86CW5.pdb.gz	Q86CW5_DROME Hmr OS=Drosophila melanogaster OX=7227 GN=Hmr PE=4 SV=1
18	AFDB:F4JKH6	0.054	0.038	2.415E-1	1819	0.092	0.058	F4JKH6.pdb.gz	REC2_ARATH Protein REDUCED CHLOROPLAST COVERAGE 2 OS=Arabidopsis thaliana OX=3702 GN=REC2 PE=1 SV=1
19	AFDB:F4HZK4	0.052	0.041	2.977E-1	1608	0.073	0.052	F4HZK4.pdb.gz	REC3_ARATH Protein REDUCED CHLOROPLAST COVERAGE 3 OS=Arabidopsis thaliana OX=3702 GN=REC3 PE=3 SV=1
20	AFDB:F4JCS8	0.056	0.046	3.137E-1	1613	0.094	0.066	F4JCS8.pdb.gz	F4JCS8_ARATH Protein SUO OS=Arabidopsis thaliana OX=3702 GN=SUO PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	I0IUP4	0.0	1251	1169	0.598	0.585	MCM9_CHICK DNA helicase MCM9 OS=Gallus gallus OX=9031 GN=MCM9 PE=1 SV=2
2	Q2KHI9	0.0	1648	1134	0.745	0.750	MCM9_MOUSE DNA helicase MCM9 OS=Mus musculus OX=10090 GN=Mcm9 PE=1 SV=2
3	Q9NXL9	0.0	2370	1143	1.000	1.000	MCM9_HUMAN DNA helicase MCM9 OS=Homo sapiens OX=9606 GN=MCM9 PE=1 SV=4
4	Q9UXG1	1.72e-90	308	686	0.166	0.277	MCM_SACS2 Minichromosome maintenance protein MCM OS=Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) OX=273057 GN=MCM PE=1 SV=1
5	P55861	1.32e-87	305	886	0.174	0.225	MCM2_XENLA DNA replication licensing factor mcm2 OS=Xenopus laevis OX=8355 GN=mcm2 PE=1 SV=2
6	P49736	7.74e-87	303	904	0.181	0.229	MCM2_HUMAN DNA replication licensing factor MCM2 OS=Homo sapiens OX=9606 GN=MCM2 PE=1 SV=4
7	P97310	2.07e-86	302	904	0.182	0.230	MCM2_MOUSE DNA replication licensing factor MCM2 OS=Mus musculus OX=10090 GN=Mcm2 PE=1 SV=3
8	P49735	2.58e-86	301	887	0.174	0.224	MCM2_DROME DNA replication licensing factor Mcm2 OS=Drosophila melanogaster OX=7227 GN=Mcm2 PE=1 SV=1
9	D3ZP96	4.35e-86	301	905	0.182	0.230	D3ZP96_RAT DNA replication licensing factor MCM2 OS=Rattus norvegicus OX=10116 GN=Mcm2 PE=1 SV=2
10	A0A0R4IF65	5.40e-85	298	889	0.179	0.231	A0A0R4IF65_DANRE DNA replication licensing factor MCM2 OS=Danio rerio OX=7955 GN=cb737 PE=1 SV=1
11	C4LYY1	2.80e-84	295	881	0.171	0.221	C4LYY1_ENTH1 DNA replication licensing factor MCM2 OS=Entamoeba histolytica (strain ATCC 30459 / HM-1:IMSS / ABRM) OX=294381 GN=EHI_117970 PE=3 SV=1
12	Q9XXI9	3.05e-79	281	881	0.178	0.230	Q9XXI9_CAEEL DNA replication licensing factor MCM2 OS=Caenorhabditis elegans OX=6239 GN=mcm-2 PE=1 SV=1
13	O16297	1.07e-78	276	730	0.155	0.242	O16297_CAEEL DNA replication licensing factor MCM7 OS=Caenorhabditis elegans OX=6239 GN=mcm-7 PE=1 SV=1
14	I0IUP3	1.28e-78	278	830	0.170	0.234	MCM8_CHICK DNA helicase MCM8 OS=Gallus gallus OX=9031 GN=MCM8 PE=1 SV=1
15	Q7ZY18	2.13e-78	277	825	0.157	0.218	MC6ZB_XENLA Zygotic DNA replication licensing factor mcm6-B OS=Xenopus laevis OX=8355 GN=zmcm6-b PE=1 SV=1
16	Q5FWY4	5.00e-78	276	821	0.156	0.217	MCM6M_XENLA Maternal DNA replication licensing factor mcm6 OS=Xenopus laevis OX=8355 GN=mmcm6 PE=1 SV=1
17	Q1PS21	7.32e-78	273	719	0.164	0.261	Q1PS21_RAT DNA replication licensing factor MCM7 OS=Rattus norvegicus OX=10116 GN=Mcm7 PE=2 SV=1
18	F7F0X7	1.34e-77	273	717	0.164	0.262	F7F0X7_RAT DNA replication licensing factor MCM7 OS=Rattus norvegicus OX=10116 GN=Mcm7 PE=1 SV=1
19	Q9CWV1	1.66e-77	275	833	0.177	0.242	MCM8_MOUSE DNA helicase MCM8 OS=Mus musculus OX=10090 GN=Mcm8 PE=1 SV=3
20	Q498J7	1.68e-77	275	823	0.157	0.219	MC6ZA_XENLA Zygotic DNA replication licensing factor mcm6-A OS=Xenopus laevis OX=8355 GN=zmcm6-a PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00004 AAA	5.1e+02	12.5	ATPase family associated with various cellular activities (AAA)
2	PF13191 AAA_16	2.1e+02	13.6	AAA ATPase domain
3	PF07726 AAA_3	3.1	19.1	ATPase family associated with various cellular activities (AAA)
4	PF07728 AAA_5	0.00017	33.1	AAA domain (dynein-related subfamily)
5	PF12775 AAA_7	4.3e+02	11.8	P-loop containing dynein motor region
6	PF00493 MCM	9.3e-74	258.8	MCM P-loop domain
7	PF17855 MCM_lid	2.7e-12	58.3	MCM AAA-lid domain
8	PF17207 MCM_OB	3.7e-20	83.5	MCM OB domain
9	PF01078 Mg_chelatase	1.7e-05	35.8	Magnesium chelatase, subunit ChlI

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000314505

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000368164	0.996	DNA helicase MCM8
2	9606.ENSP00000480987	0.990	DNA replication licensing factor MCM3
3	9606.ENSP00000353098	0.981	Mini-chromosome maintenance complex-binding protein
4	9606.ENSP00000307288	0.980	DNA replication licensing factor MCM7
5	9606.ENSP00000262105	0.979	DNA replication licensing factor MCM4
6	9606.ENSP00000216122	0.978	DNA replication licensing factor MCM5
7	9606.ENSP00000353793	0.978	WD repeat and HMG-box DNA-binding protein 1
8	9606.ENSP00000322570	0.973	DNA polymerase epsilon catalytic subunit A
9	9606.ENSP00000209728	0.969	Cell division control protein 6 homolog
10	9606.ENSP00000264156	0.963	DNA replication licensing factor MCM6
11	9606.ENSP00000234296	0.962	Origin recognition complex subunit 2
12	9606.ENSP00000276533	0.956	DNA replication complex GINS protein SLD5
13	9606.ENSP00000405726	0.955	Cell division control protein 45 homolog
14	9606.ENSP00000360623	0.947	Origin recognition complex subunit 1
15	9606.ENSP00000450607	0.944	Protein timeless homolog
16	9606.ENSP00000297431	0.942	Origin recognition complex subunit 5
17	9606.ENSP00000418268	0.939	Protein MCM10 homolog
18	9606.ENSP00000441953	0.937	Origin recognition complex subunit 4
19	9606.ENSP00000261881	0.934	TIMELESS-interacting protein
20	9606.ENSP00000216367	0.932	DNA polymerase epsilon subunit 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0003682	0.999	chromatin binding
GO:0003678	0.999	DNA helicase activity
GO:0019899	0.970	enzyme binding
GO:0003676	0.855	nucleic acid binding
GO:0003677	0.726	DNA binding
GO:0044877	0.636	protein-containing complex binding
GO:0032407	0.418	MutSalpha complex binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043170	0.996	macromolecule metabolic process
GO:0006139	0.995	nucleobase-containing compound metabolic process
GO:0006259	0.993	DNA metabolic process
GO:0071840	0.969	cellular component organization or biogenesis
GO:0050896	0.958	response to stimulus
GO:0016043	0.958	cellular component organization
GO:0006261	0.957	DNA-templated DNA replication
GO:0006310	0.940	DNA recombination
GO:0006302	0.936	double-strand break repair
GO:0006996	0.933	organelle organization
GO:0000725	0.915	recombinational repair
GO:0000724	0.895	double-strand break repair via homologous recombination
GO:0051276	0.889	chromosome organization
GO:0032508	0.834	DNA duplex unwinding
GO:0006298	0.810	mismatch repair
GO:0065007	0.734	biological regulation
GO:0050789	0.702	regulation of biological process
GO:0045005	0.673	DNA-templated DNA replication maintenance of fidelity
GO:0050794	0.588	regulation of cellular process
GO:0019222	0.348	regulation of metabolic process
GO:0060255	0.342	regulation of macromolecule metabolic process
GO:0080090	0.340	regulation of primary metabolic process
GO:0051171	0.340	regulation of nitrogen compound metabolic process
GO:0019219	0.331	regulation of nucleobase-containing compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032991	1.000	protein-containing complex
GO:0005634	1.000	nucleus
GO:0042555	0.993	MCM complex
GO:0005654	0.962	nucleoplasm
GO:0043232	0.955	intracellular non-membrane-bounded organelle
GO:0005694	0.897	chromosome
GO:0005737	0.502	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]