StarFunc result for job id Q9NXR8

User Input

>input (418 residues)
MLYLEDYLEMIEQLPMDLRDRFTEMREMDLQVQNAMDQLEQRVSEFFMNAKKNKPEWREE
QMASIKKDYYKALEDADEKVQLANQIYDLVDRHLRKLDQELAKFKMELEADNAGITEILE
RRSLELDTPSQPVNNHHAHSHTPVEKRKYNPTSHHTTTDHIPEKKFKSEALLSTLTSDAS
KENTLGCRNNNSTASSNNAYNVNSSQPLGSYNIGSLSSGTGAGAITMAAAQAVQATAQMK
EGRRTSSLKASYEAFKNNDFQLGKEFSMARETVGYSSSSALMTTLTQNASSSAADSRSGR
KSKNNNKSSSQQSSSSSSSSSLSSCSSSSTVVQEISQQTTVVPESDSNSQVDWTYDPNEP
RYCICNQVSYGEMVGCDNQDCPIEWFHYGCVGLTEAPKGKWYCPQCTAAMKRRGSRHK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9NXR8	0.999	0.999	2.386E-58	418	1.000	1.000	Q9NXR8.pdb.gz	ING3_HUMAN Inhibitor of growth protein 3 OS=Homo sapiens OX=9606 GN=ING3 PE=1 SV=2
2	AFDB:Q9VEF5	0.241	0.234	5.185E-15	433	0.237	0.229	Q9VEF5.pdb.gz	Q9VEF5_DROME Inhibitor of growth protein OS=Drosophila melanogaster OX=7227 GN=Dmel\CG7379 PE=1 SV=1
3	AFDB:P15276	0.238	0.280	4.836E-4	352	0.096	0.114	P15276.pdb.gz	ALGP_PSEAE Transcriptional regulatory protein AlgP OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=algP PE=4 SV=2
4	AFDB:Q500P4	0.231	0.281	7.031E-4	338	0.089	0.109	Q500P4.pdb.gz	Q500P4_PSEU2 Alginate regulatory protein AlgR3 OS=Pseudomonas syringae pv. syringae (strain B728a) OX=205918 GN=Psyr_0054 PE=4 SV=1
5	PDB:7vvuV	0.230	0.775	3.885E-3	113	0.067	0.248	7vvuV.pdb.gz	Structure of the NuA4 acetyltransferase complex bound to the nucleosome.
6	AFDB:Q581A4	0.145	0.084	1.027E-2	741	0.120	0.067	Q581A4.pdb.gz	Q581A4_TRYB2 C2 NT-type domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.10J17.430 PE=4 SV=1
7	AFDB:A0A0B4K774	0.207	0.184	1.093E-2	477	0.141	0.124	A0A0B4K774.pdb.gz	A0A0B4K774_DROME Abelson interacting protein, isoform D OS=Drosophila melanogaster OX=7227 GN=Abi PE=1 SV=1
8	AFDB:Q8CBW3	0.178	0.157	1.590E-2	481	0.148	0.129	Q8CBW3.pdb.gz	ABI1_MOUSE Abl interactor 1 OS=Mus musculus OX=10090 GN=Abi1 PE=1 SV=3
9	AFDB:Q10929	0.196	0.176	2.040E-2	469	0.136	0.122	Q10929.pdb.gz	Q10929_CAEEL SH3 domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=abi-1 PE=1 SV=2
10	AFDB:Q62018	0.161	0.064	2.966E-2	1173	0.117	0.042	Q62018.pdb.gz	CTR9_MOUSE RNA polymerase-associated protein CTR9 homolog OS=Mus musculus OX=10090 GN=Ctr9 PE=1 SV=2
11	AFDB:Q66IV2	0.180	0.152	2.966E-2	503	0.136	0.113	Q66IV2.pdb.gz	Q66IV2_XENLA Abl interactor 1 S homeolog OS=Xenopus laevis OX=8355 GN=abi1.S PE=2 SV=1
12	PDB:4n78F	0.198	0.496	5.011E-2	156	0.050	0.135	4n78F.pdb.gz	The WAVE Regulatory Complex Links Diverse Receptors to the Actin Cytoskeleton.
13	PDB:7lbmn	0.107	0.144	1.857E-1	283	0.062	0.092	7lbmn.pdb.gz	Structure of the human Mediator-bound transcription preinitiation complex.
14	PDB:5n9jG	0.158	0.349	2.383E-1	163	0.043	0.110	5n9jG.pdb.gz
15	PDB:3hajA	0.182	0.253	2.699E-1	286	0.038	0.056	3hajA.pdb.gz	Molecular mechanism of membrane constriction and tubulation mediated by the F-BAR protein Pacsin/Syndapin.
16	PDB:5mkkA	0.171	0.130	2.699E-1	593	0.043	0.030	5mkkA.pdb.gz
17	PDB:7enal	0.084	0.242	3.687E-1	126	0.033	0.111	7enal.pdb.gz	Structures of the human Mediator and Mediator-bound preinitiation complex.
18	PDB:4q4aA	0.186	0.144	4.445E-1	572	0.036	0.026	4q4aA.pdb.gz	Structural basis for allosteric cross-talk between the asymmetric nucleotide binding sites of a heterodimeric ABC exporter.
19	PDB:1ykhB	0.108	0.274	5.036E-1	114	0.048	0.175	1ykhB.pdb.gz
20	PDB:3k29A	0.230	0.540	6.463E-1	162	0.038	0.099	3k29A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	E7ET07	0.0	845	403	0.964	1.000	E7ET07_HUMAN Inhibitor of growth protein OS=Homo sapiens OX=9606 GN=ING3 PE=1 SV=1
2	Q9NXR8	0.0	877	418	1.000	1.000	ING3_HUMAN Inhibitor of growth protein 3 OS=Homo sapiens OX=9606 GN=ING3 PE=1 SV=2
3	A0A0C4DG38	1.74e-59	190	99	0.215	0.909	A0A0C4DG38_HUMAN Inhibitor of growth family member 3 OS=Homo sapiens OX=9606 GN=ING3 PE=1 SV=1
4	Q8MR26	1.24e-49	174	387	0.194	0.209	Q8MR26_DROME LD24232p OS=Drosophila melanogaster OX=7227 GN=Ing3 PE=2 SV=1
5	Q9VWS0	2.55e-47	174	686	0.194	0.118	Q9VWS0_DROME Inhibitor of growth protein OS=Drosophila melanogaster OX=7227 GN=Ing3 PE=1 SV=1
6	Q9LIQ6	1.17e-31	122	234	0.112	0.201	ING1_ARATH PHD finger protein ING1 OS=Arabidopsis thaliana OX=3702 GN=ING1 PE=1 SV=1
7	Q9VJY8	4.36e-31	122	285	0.120	0.175	ING5_DROME Inhibitor of growth protein 5 OS=Drosophila melanogaster OX=7227 GN=Ing5 PE=1 SV=2
8	Q4VBS0	2.72e-29	116	250	0.124	0.208	Q4VBS0_DANRE Inhibitor of growth protein OS=Danio rerio OX=7955 GN=wu:fb11d09 PE=2 SV=1
9	Q9QXV3	3.69e-29	117	279	0.100	0.151	ING1_MOUSE Inhibitor of growth protein 1 OS=Mus musculus OX=10090 GN=Ing1 PE=2 SV=1
10	Q9D8Y8	6.94e-29	115	240	0.096	0.167	ING5_MOUSE Inhibitor of growth protein 5 OS=Mus musculus OX=10090 GN=Ing5 PE=1 SV=1
11	Q9H160	1.09e-28	115	280	0.100	0.150	ING2_HUMAN Inhibitor of growth protein 2 OS=Homo sapiens OX=9606 GN=ING2 PE=1 SV=2
12	Q9ESK4	1.13e-28	115	281	0.100	0.149	ING2_MOUSE Inhibitor of growth protein 2 OS=Mus musculus OX=10090 GN=Ing2 PE=1 SV=3
13	Q8WYH8	1.20e-28	114	240	0.096	0.167	ING5_HUMAN Inhibitor of growth protein 5 OS=Homo sapiens OX=9606 GN=ING5 PE=1 SV=1
14	Q9UNL4	1.44e-28	114	249	0.096	0.161	ING4_HUMAN Inhibitor of growth protein 4 OS=Homo sapiens OX=9606 GN=ING4 PE=1 SV=1
15	Q8C0D7	1.56e-28	114	249	0.096	0.161	ING4_MOUSE Inhibitor of growth protein 4 OS=Mus musculus OX=10090 GN=Ing4 PE=1 SV=2
16	Q54PN9	2.35e-27	113	324	0.098	0.127	ING1_DICDI Inhibitor of growth protein 1 homolog OS=Dictyostelium discoideum OX=44689 GN=dng1 PE=1 SV=1
17	Q9UK53	1.59e-26	112	422	0.100	0.100	ING1_HUMAN Inhibitor of growth protein 1 OS=Homo sapiens OX=9606 GN=ING1 PE=1 SV=2
18	P50947	4.59e-21	95.5	330	0.084	0.106	PHO23_YEAST Transcriptional regulatory protein PHO23 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PHO23 PE=1 SV=1
19	Q08465	1.24e-19	89.0	219	0.079	0.151	YNG1_YEAST Protein YNG1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YNG1 PE=1 SV=1
20	B3H615	8.12e-19	87.8	262	0.084	0.134	ING2_ARATH PHD finger protein ING2 OS=Arabidopsis thaliana OX=3702 GN=ING2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12998 ING	7.5e-28	108.4	Inhibitor of growth proteins N-terminal histone-binding
2	PF09803 Pet100	2.5e+02	13.4	Pet100
3	PF00628 PHD	0.0049	28.0	PHD-finger
4	PF01259 SAICAR_synt	1.5e+02	13.4	SAICAR synthetase
5	PF13771 zf-HC5HC2H	4.9e+02	12.4	PHD-like zinc-binding domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000014397

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000007058	0.996	K(lysine) acetyltransferase 5
2	61853.ENSNLEP00000010671	0.985	Mortality factor 4 like 1
3	61853.ENSNLEP00000004637	0.982	YEATS domain containing 4
4	61853.ENSNLEP00000012065	0.982	MRG/MORF4L binding protein
5	61853.ENSNLEP00000014063	0.982	MYST/Esa1-associated factor 6
6	61853.ENSNLEP00000017307	0.982	RuvB-like helicase
7	61853.ENSNLEP00000016981	0.968	DNA methyltransferase 1 associated protein 1
8	61853.ENSNLEP00000022030	0.968	Enhancer of polycomb homolog 1 (Drosophila)
9	61853.ENSNLEP00000010657	0.952	Bromodomain containing 8
10	61853.ENSNLEP00000011131	0.952	Enhancer of polycomb homolog 2 (Drosophila)
11	61853.ENSNLEP00000005920	0.950	RuvB-like helicase
12	61853.ENSNLEP00000019626	0.936	K(lysine) acetyltransferase 8
13	61853.ENSNLEP00000023892	0.936	Uncharacterized protein
14	61853.ENSNLEP00000011918	0.932	Acidic (leucine-rich) nuclear phosphoprotein 32 family, member E
15	61853.ENSNLEP00000007056	0.927	Actin-like 6A
16	61853.ENSNLEP00000010409	0.924	E1A binding protein p400
17	61853.ENSNLEP00000018822	0.922	Uncharacterized protein
18	61853.ENSNLEP00000010340	0.913	Uncharacterized protein
19	61853.ENSNLEP00000011055	0.913	MSL complex subunit 3
20	61853.ENSNLEP00000019381	0.909	Snf2-related CREBBP activator protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0035064	1.000	methylated histone binding
GO:0010485	1.000	histone H4 acetyltransferase activity
GO:0043998	0.571	histone H2A acetyltransferase activity
GO:0043996	0.555	histone H4K8 acetyltransferase activity
GO:0043995	0.555	histone H4K5 acetyltransferase activity
GO:0043997	0.550	histone H4K12 acetyltransferase activity
GO:0046972	0.541	histone H4K16 acetyltransferase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.995	organic substance metabolic process
GO:0044238	0.995	primary metabolic process
GO:0043967	0.991	histone H4 acetylation
GO:0051052	0.990	regulation of DNA metabolic process
GO:0010604	0.988	positive regulation of macromolecule metabolic process
GO:0045935	0.986	positive regulation of nucleobase-containing compound metabolic process
GO:0080135	0.985	regulation of cellular response to stress
GO:0048584	0.984	positive regulation of response to stimulus
GO:0051726	0.979	regulation of cell cycle
GO:2001020	0.977	regulation of response to DNA damage stimulus
GO:2001022	0.972	positive regulation of response to DNA damage stimulus
GO:2000779	0.961	regulation of double-strand break repair
GO:0000018	0.951	regulation of DNA recombination
GO:0045739	0.939	positive regulation of DNA repair
GO:2000781	0.931	positive regulation of double-strand break repair
GO:0010569	0.914	regulation of double-strand break repair via homologous recombination
GO:0045911	0.889	positive regulation of DNA recombination
GO:0009987	0.793	cellular process
GO:0010468	0.580	regulation of gene expression
GO:0051252	0.565	regulation of RNA metabolic process
GO:0031326	0.556	regulation of cellular biosynthetic process
GO:0010556	0.551	regulation of macromolecule biosynthetic process
GO:1903506	0.458	regulation of nucleic acid-templated transcription
GO:0006355	0.452	regulation of DNA-templated transcription
GO:0071840	0.418	cellular component organization or biogenesis
GO:0016043	0.412	cellular component organization
GO:0006325	0.361	chromatin organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:1902494	0.998	catalytic complex
GO:0000785	0.998	chromatin
GO:0000123	0.975	histone acetyltransferase complex
GO:1902562	0.959	H4 histone acetyltransferase complex
GO:0140513	0.945	nuclear protein-containing complex
GO:0070603	0.939	SWI/SNF superfamily-type complex
GO:0000228	0.905	nuclear chromosome
GO:0043189	0.833	H4/H2A histone acetyltransferase complex
GO:0035267	0.754	NuA4 histone acetyltransferase complex
GO:0032993	0.686	protein-DNA complex
GO:0000786	0.660	nucleosome
GO:0000118	0.657	histone deacetylase complex
GO:0097346	0.649	INO80-type complex
GO:0000812	0.504	Swr1 complex
GO:0032777	0.393	Piccolo NuA4 histone acetyltransferase complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:21992	1.000	acetyl-CoA + L-lysyl-[histone] = CoA + H(+) + N(6)-acetyl-L-lysyl-[histone]
EC:2.3.1.48	1.000	histone acetyltransferase.

[back to server]