StarFunc result for job id Q9NXV6

User Input

>input (580 residues)
MAQEVSEYLSQNPRVAAWVEALRCDGETDKHWRHRRDFLLRNAGDLAPAGGAASASTDEA
ADAESGTRNRQLQQLISFSMAWANHVFLGCRYPQKVMDKILSMAEGIKVTDAPTYTTRDE
LVAKVKKRGISSSNEGVEEPSKKRVIEGKNSSAVEQDHAKTSAKTERASAQQENSSTCIG
SAIKSESGNSARSSGISSQNSSTSDGDRSVSSQSSSSVSSQVTTAGSGKASEAEAPDKHG
SASFVSLLKSSVNSHMTQSTDSRQQSGSPKKSALEGSSASASQSSSEIEVPLLGSSGSSE
VELPLLSSKPSSETASSGLTSKTSSEASVSSSVAKNSSSSGTSLLTPKSSSSTNTSLLTS
KSTSQVAASLLASKSSSQTSGSLVSKSTSLASVSQLASKSSSQTSTSQLPSKSTSQSSES
SVKFSCKLTNEDVKQKQPFFNRLYKTVAWKLVAVGGFSPNVNHGELLNAAIEALKATLDV
FFVPLKELADLPQNKSSQESIVCELRCKSVYLGTGCGKSKENAKAVASREALKLFLKKKV
VVKICKRKYRGSEIEDLVLLDEESRPVNLPPALKHPQELL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9NXV6	0.999	0.999	9.580E-75	580	1.000	1.000	Q9NXV6.pdb.gz	CARF_HUMAN CDKN2A-interacting protein OS=Homo sapiens OX=9606 GN=CDKN2AIP PE=1 SV=3
2	AFDB:Q8BI72	0.304	0.312	5.157E-63	563	0.850	0.876	Q8BI72.pdb.gz	CARF_MOUSE CDKN2A-interacting protein OS=Mus musculus OX=10090 GN=Cdkn2aip PE=1 SV=1
3	PDB:8dgaK	0.137	0.377	2.575E-3	182	0.026	0.082	8dgaK.pdb.gz	Structural basis of microRNA biogenesis by Dicer-1 and its partner protein Loqs-PB.
4	PDB:7zpkC	0.124	0.288	4.500E-3	233	0.034	0.086	7zpkC.pdb.gz	Structural and functional basis of mammalian microRNA biogenesis by Dicer.
5	PDB:8dfvK	0.137	0.285	4.500E-3	253	0.026	0.059	8dfvK.pdb.gz	Structural basis of microRNA biogenesis by Dicer-1 and its partner protein Loqs-PB.
6	PDB:3j6b5	0.108	0.186	2.147E-2	326	0.026	0.046	3j6b5.pdb.gz	Structure of the yeast mitochondrial large ribosomal subunit.
7	PDB:1yykA	0.111	0.272	2.270E-2	221	0.024	0.063	1yykA.pdb.gz	Intermediate states of ribonuclease III in complex with double-stranded RNA
8	PDB:7l08c	0.111	0.208	2.270E-2	289	0.031	0.062	7l08c.pdb.gz	Distinct mechanisms of the human mitoribosome recycling and antibiotic resistance.
9	PDB:7v6cB	0.100	0.216	7.750E-2	260	0.028	0.062	7v6cB.pdb.gz	Structure of the Dicer-2-R2D2 heterodimer bound to a small RNA duplex.
10	PDB:6xywBd	0.085	0.202	1.281E-1	216	0.034	0.093	6xywBd.pdb.gz	Cryo-EM structure of the RNA-rich plant mitochondrial ribosome.
11	PDB:5mrcEE	0.104	0.177	3.497E-1	288	0.028	0.056	5mrcEE.pdb.gz	The structure of the yeast mitochondrial ribosome.
12	PDB:4q86B	0.080	0.079	5.169E-1	583	0.022	0.022	4q86B.pdb.gz	Discovery of a new ATP-binding motif involved in peptidic azoline biosynthesis.
13	AFDB:Q9VS24	0.088	0.050	6.095E-1	994	0.150	0.088	Q9VS24.pdb.gz	MELT_DROME Protein melted OS=Drosophila melanogaster OX=7227 GN=melt PE=1 SV=2
14	AFDB:C9J4J4	0.056	0.081	6.815E-1	375	0.086	0.133	C9J4J4.pdb.gz	C9J4J4_HUMAN Myocyte enhancer factor 2B OS=Homo sapiens OX=9606 GN=MEF2B PE=1 SV=1
15	AFDB:Q9U7E0	0.059	0.032	6.815E-1	1359	0.143	0.061	Q9U7E0.pdb.gz	ATRX_CAEEL Transcriptional regulator ATRX homolog OS=Caenorhabditis elegans OX=6239 GN=xnp-1 PE=1 SV=1
16	AFDB:O75170	0.069	0.045	7.620E-1	966	0.121	0.072	O75170.pdb.gz	PP6R2_HUMAN Serine/threonine-protein phosphatase 6 regulatory subunit 2 OS=Homo sapiens OX=9606 GN=PPP6R2 PE=1 SV=2
17	AFDB:H3BNR1	0.072	0.095	8.057E-1	382	0.098	0.149	H3BNR1.pdb.gz	H3BNR1_HUMAN BORCS8-MEF2B readthrough OS=Homo sapiens OX=9606 GN=BORCS8-MEF2B PE=4 SV=3
18	AFDB:Q1LUT2	0.047	0.022	1.259	1618	0.136	0.049	Q1LUT2.pdb.gz	Q1LUT2_DANRE DNA topoisomerase 2 OS=Danio rerio OX=7955 GN=im:7138121 PE=1 SV=1
19	AFDB:Q9DG07	0.087	0.092	1.331	530	0.122	0.134	Q9DG07.pdb.gz	Q9DG07_CHICK SLP-76 adaptor protein OS=Gallus gallus OX=9031 GN=SLP76 PE=1 SV=1
20	AFDB:Q6FSJ1	0.077	0.077	1.489	577	0.150	0.151	Q6FSJ1.pdb.gz	Q6FSJ1_CANGA Candida glabrata strain CBS138 chromosome G complete sequence OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=AWP6 PE=4 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8BI72	0.0	818	563	0.840	0.865	CARF_MOUSE CDKN2A-interacting protein OS=Mus musculus OX=10090 GN=Cdkn2aip PE=1 SV=1
2	Q9NXV6	0.0	1152	580	1.000	1.000	CARF_HUMAN CDKN2A-interacting protein OS=Homo sapiens OX=9606 GN=CDKN2AIP PE=1 SV=3
3	F1QZX8	1.69e-52	184	312	0.157	0.292	F1QZX8_DANRE CDKN2A-interacting protein OS=Danio rerio OX=7955 GN=zgc:101658 PE=1 SV=1
4	Q5XJR4	2.31e-52	183	312	0.157	0.292	Q5XJR4_DANRE CDKN2A-interacting protein OS=Danio rerio OX=7955 GN=CARF PE=1 SV=1
5	Q96HQ2	1.01e-20	89.7	116	0.079	0.397	C2AIL_HUMAN CDKN2AIP N-terminal-like protein OS=Homo sapiens OX=9606 GN=CDKN2AIPNL PE=1 SV=1
6	A3F769	6.93e-19	92.8	690	0.114	0.096	A3F769_HUMAN NF-kappaB repressing factor OS=Homo sapiens OX=9606 GN=NRF PE=2 SV=1
7	O15226	6.93e-19	92.8	690	0.114	0.096	NKRF_HUMAN NF-kappa-B-repressing factor OS=Homo sapiens OX=9606 GN=NKRF PE=1 SV=2
8	M9PC41	0.005	42.7	22743	0.097	0.002	M9PC41_DROME Dumpy, isoform O OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
9	M9PC45	0.005	42.4	22300	0.097	0.003	M9PC45_DROME Dumpy, isoform T OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
10	M9PB30	0.006	42.4	22949	0.097	0.002	M9PB30_DROME Dumpy, isoform Q OS=Drosophila melanogaster OX=7227 GN=dpy PE=1 SV=1
11	M9PBZ0	0.006	42.4	22830	0.097	0.002	M9PBZ0_DROME Dumpy, isoform R OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
12	M9PEI1	0.006	42.4	21657	0.097	0.003	M9PEI1_DROME Dumpy, isoform U OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
13	M9PB31	0.007	42.0	20404	0.097	0.003	M9PB31_DROME Dumpy, isoform V OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
14	M9PEH5	0.007	42.0	20710	0.097	0.003	M9PEH5_DROME Dumpy, isoform P OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
15	M9PB32	0.008	42.0	19560	0.097	0.003	M9PB32_DROME Dumpy, isoform AA OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
16	M9PBZ4	0.012	41.2	18014	0.097	0.003	M9PBZ4_DROME Dumpy, isoform W OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
17	M9NER8	0.026	40.0	15638	0.097	0.004	M9NER8_DROME Dumpy, isoform I OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
18	M9PCJ8	0.026	40.4	14825	0.097	0.004	M9PCJ8_DROME Dumpy, isoform X OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
19	M9NCR4	0.030	40.0	15105	0.097	0.004	M9NCR4_DROME Dumpy, isoform J OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF10281 Ish1	71	15.1	Putative nuclear envelope organisation protein
2	PF11952 XTBD	1.3e-27	106.7	XRN-Two Binding Domain, XTBD

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000427108

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000366396	0.977	5'-3' exoribonuclease 2
2	9606.ENSP00000418915	0.975	Cyclin-dependent kinase inhibitor 2A
3	9606.ENSP00000258169	0.728	M-phase phosphoprotein 6
4	9606.ENSP00000343635	0.704	TLD domain-containing protein 1
5	9606.ENSP00000311984	0.698	ATP-dependent (S)-NAD(P)H-hydrate dehydratase
6	9606.ENSP00000376732	0.627	Mitochondrial ribosomal protein S33
7	9606.ENSP00000258149	0.552	E3 ubiquitin-protein ligase Mdm2
8	9606.ENSP00000248072	0.542	Olfactory receptor 7C2
9	9606.ENSP00000360727	0.521	Rab-like protein 6
10	9606.ENSP00000403172	0.515	60S ribosomal protein L6
11	9606.ENSP00000356448	0.511	Nucleoprotein TPR

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0002039	1.000	p53 binding
GO:0003676	0.417	nucleic acid binding
GO:0003723	0.413	RNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.997	regulation of biological process
GO:0009987	0.995	cellular process
GO:0050896	0.981	response to stimulus
GO:0050794	0.978	regulation of cellular process
GO:0045926	0.977	negative regulation of growth
GO:0051128	0.973	regulation of cellular component organization
GO:0051716	0.969	cellular response to stimulus
GO:0001558	0.953	regulation of cell growth
GO:0048523	0.947	negative regulation of cellular process
GO:0006950	0.921	response to stress
GO:0009966	0.920	regulation of signal transduction
GO:0033554	0.899	cellular response to stress
GO:0048522	0.883	positive regulation of cellular process
GO:0045927	0.864	positive regulation of growth
GO:0048584	0.859	positive regulation of response to stimulus
GO:0023056	0.856	positive regulation of signaling
GO:0030308	0.843	negative regulation of cell growth
GO:0010647	0.823	positive regulation of cell communication
GO:0008152	0.701	metabolic process
GO:0065008	0.688	regulation of biological quality
GO:0031647	0.680	regulation of protein stability
GO:0071704	0.624	organic substance metabolic process
GO:0044237	0.510	cellular metabolic process
GO:0006974	0.493	cellular response to DNA damage stimulus
GO:0009967	0.456	positive regulation of signal transduction
GO:0043170	0.413	macromolecule metabolic process
GO:0044238	0.412	primary metabolic process
GO:0006807	0.374	nitrogen compound metabolic process
GO:0030307	0.361	positive regulation of cell growth

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.997	nucleoplasm
GO:0043232	0.995	intracellular non-membrane-bounded organelle
GO:0005730	0.899	nucleolus
GO:0005737	0.572	cytoplasm
GO:0005829	0.511	cytosol
GO:0016020	0.490	membrane
GO:0001652	0.364	granular component

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]