StarFunc result for job id Q9NXX6

User Input

>input (385 residues)
MSGDSSGRGPEGRGRGRDPHRDRTRSRSRSRSPLSPRSRRGSARERREAPERPSLEDTEP
SDSGDEMMDPASLEAEADQGLCRQIRHQYRALINSVQQNREDILNAGDKLTEVLEEANTL
FNEVSRAREAVLDAHFLVLASDLGKEKAKQLRSDLSSFDMLRYVETLLTHMGVNPLEAEE
LIRDEDSPDFEFIVYDSWKITGRTAENTFNKTHTFHFLLGSIYGECPVPKPRVDRPRKVP
VIQEERAMPAQLRRMEESHQEATEKEVERILGLLQTYFREDPDTPMSFFDFVVDPHSFPR
TVENIFHVSFIIRDGFARIRLDQDRLPVIEPVSINEENEGFEHNTQVRNQGIIALSYRDW
EEIVKTFEISEPVITPSQRQQKPSA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9NXX6	1.000	1.000	4.354E-59	385	1.000	1.000	Q9NXX6.pdb.gz	NSE4A_HUMAN Non-structural maintenance of chromosomes element 4 homolog A OS=Homo sapiens OX=9606 GN=NSMCE4A PE=1 SV=2
2	AFDB:A0A140VJI9	0.311	0.358	3.333E-29	333	0.434	0.502	A0A140VJI9.pdb.gz	A0A140VJI9_HUMAN Non-structural maintenance of chromosomes element 4 OS=Homo sapiens OX=9606 PE=2 SV=1
3	AFDB:Q54T56	0.305	0.318	2.409E-17	367	0.223	0.234	Q54T56.pdb.gz	Q54T56_DICDI Non-structural maintenance of chromosomes element 4 OS=Dictyostelium discoideum OX=44689 GN=DDB_G0281991 PE=3 SV=1
4	AFDB:Q6BDR8	0.251	0.315	4.164E-15	300	0.197	0.253	Q6BDR8.pdb.gz	NSE4_SCHPO Non-structural maintenance of chromosome element 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=nse4 PE=1 SV=1
5	AFDB:Q9VKV4	0.276	0.359	3.375E-12	290	0.166	0.221	Q9VKV4.pdb.gz	Q9VKV4_DROME Non-structural maintenance of chromosomes element 4 OS=Drosophila melanogaster OX=7227 GN=Nse4 PE=1 SV=2
6	AFDB:Q9C689	0.244	0.234	7.966E-12	403	0.179	0.171	Q9C689.pdb.gz	NSE4A_ARATH Non-structural maintenance of chromosomes element 4 homolog A OS=Arabidopsis thaliana OX=3702 GN=NSE4A PE=2 SV=1
7	PDB:7qcdF	0.247	0.361	1.983E-9	257	0.151	0.226	7qcdF.pdb.gz	Cryo-EM structure of the Smc5/6 holo-complex.
8	PDB:7tveG	0.191	0.234	1.238E-8	307	0.179	0.225	7tveG.pdb.gz	Cryo-EM structure of DNA-bound Smc5/6 reveals DNA clamping enabled by multi-subunit conformational changes.
9	AFDB:Q08562	0.103	0.034	5.268E-2	1619	0.114	0.027	Q08562.pdb.gz	ULS1_YEAST ATP-dependent helicase ULS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ULS1 PE=1 SV=1
10	AFDB:A9V7T9	0.146	0.102	7.014E-2	628	0.143	0.088	A9V7T9.pdb.gz	A9V7T9_MONBE BZIP domain-containing protein OS=Monosiga brevicollis OX=81824 GN=MONBRDRAFT_10973 PE=1 SV=1
11	AFDB:P48234	0.094	0.057	2.081E-1	707	0.099	0.054	P48234.pdb.gz	NOL10_YEAST Ribosome biogenesis protein ENP2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ENP2 PE=1 SV=2
12	AFDB:Q21029	0.100	0.037	2.471E-1	1498	0.161	0.041	Q21029.pdb.gz	NSY1_CAEEL Mitogen-activated protein kinase kinase kinase nsy-1 OS=Caenorhabditis elegans OX=6239 GN=nsy-1 PE=1 SV=4
13	PDB:6qpqD	0.136	0.515	3.174E-1	82	0.021	0.098	6qpqD.pdb.gz
14	PDB:6yvuC	0.145	0.226	5.958E-1	235	0.065	0.106	6yvuC.pdb.gz
15	PDB:6wgeC	0.164	0.344	6.309E-1	174	0.052	0.115	6wgeC.pdb.gz	Cryo-EM structure of the human cohesin-NIPBL-DNA complex.
16	PDB:6iwtA	0.122	0.132	7.491E-1	346	0.023	0.026	6iwtA.pdb.gz
17	PDB:6wg3C	0.158	0.237	7.491E-1	248	0.081	0.125	6wg3C.pdb.gz	Cryo-EM structure of the human cohesin-NIPBL-DNA complex.
18	PDB:5v8f8	0.148	0.118	9.419E-1	519	0.055	0.040	5v8f8.pdb.gz	Structural basis of Mcm2-7 replicative helicase loading by ORC-Cdc6 and Cdt1.
19	PDB:7qp6a	0.114	0.321	1.056	99	0.021	0.081	7qp6a.pdb.gz	Conformational rearrangements upon start codon recognition in human 48S translation initiation complex.
20	PDB:7vo0G	0.126	0.313	1.056	131	0.021	0.061	7vo0G.pdb.gz	Structural basis of Streptomyces transcription activation by zinc uptake regulator.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9NXX6	0.0	786	385	1.000	1.000	NSE4A_HUMAN Non-structural maintenance of chromosomes element 4 homolog A OS=Homo sapiens OX=9606 GN=NSMCE4A PE=1 SV=2
2	A0A140VJI9	2.77e-110	328	333	0.436	0.505	A0A140VJI9_HUMAN Non-structural maintenance of chromosomes element 4 OS=Homo sapiens OX=9606 PE=2 SV=1
3	Q8N140	2.77e-110	328	333	0.436	0.505	EID3_HUMAN EP300-interacting inhibitor of differentiation 3 OS=Homo sapiens OX=9606 GN=EID3 PE=1 SV=1
4	Q54T56	1.15e-27	114	367	0.218	0.229	Q54T56_DICDI Non-structural maintenance of chromosomes element 4 OS=Dictyostelium discoideum OX=44689 GN=DDB_G0281991 PE=3 SV=1
5	Q6BDR8	3.25e-21	95.1	300	0.203	0.260	NSE4_SCHPO Non-structural maintenance of chromosome element 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=nse4 PE=1 SV=1
6	P43124	3.84e-08	57.0	402	0.073	0.070	NSE4_YEAST Non-structural maintenance of chromosome element 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=NSE4 PE=1 SV=1
7	Q9C689	3.85e-08	57.0	403	0.166	0.159	NSE4A_ARATH Non-structural maintenance of chromosomes element 4 homolog A OS=Arabidopsis thaliana OX=3702 GN=NSE4A PE=2 SV=1
8	Q9VKV4	3.95e-07	53.5	290	0.104	0.138	Q9VKV4_DROME Non-structural maintenance of chromosomes element 4 OS=Drosophila melanogaster OX=7227 GN=Nse4 PE=1 SV=2
9	Q9DCR4	0.077	36.2	169	0.075	0.172	EID1_MOUSE EP300-interacting inhibitor of differentiation 1 OS=Mus musculus OX=10090 GN=Eid1 PE=1 SV=2
10	Q9Y6B2	0.087	36.2	187	0.075	0.155	EID1_HUMAN EP300-interacting inhibitor of differentiation 1 OS=Homo sapiens OX=9606 GN=EID1 PE=1 SV=1
11	M9PFM0	0.43	34.3	173	0.060	0.133	M9PFM0_DROME Dicarboxylate carrier 4, isoform B OS=Drosophila melanogaster OX=7227 GN=Dic4 PE=3 SV=1
12	B8JIA4	1.5	33.5	1461	0.062	0.016	B8JIA4_DANRE Histone-lysine N-methyltransferase NSD2 OS=Danio rerio OX=7955 GN=fc12c04 PE=1 SV=1
13	Q9NAD6	1.8	33.1	706	0.062	0.034	STAT1_CAEEL Signal transducer and activator of transcription 1 OS=Caenorhabditis elegans OX=6239 GN=sta-1 PE=1 SV=2
14	Q9VVS1	1.8	32.7	302	0.060	0.076	Q9VVS1_DROME Dicarboxylate carrier 4, isoform A OS=Drosophila melanogaster OX=7227 GN=Dic4 PE=2 SV=1
15	I3VM53	1.9	33.1	1162	0.052	0.017	I3VM53_HUMAN F-box and leucine-rich repeat protein 11, isoform CRA_a OS=Homo sapiens OX=9606 GN=KDM2A PE=2 SV=1
16	I3VM54	1.9	33.1	1145	0.052	0.017	I3VM54_HUMAN Lysine demethylase 2A OS=Homo sapiens OX=9606 GN=KDM2A PE=1 SV=1
17	Q9Y2K7	1.9	33.1	1162	0.052	0.017	KDM2A_HUMAN Lysine-specific demethylase 2A OS=Homo sapiens OX=9606 GN=KDM2A PE=1 SV=3
18	A0A061ACU2	2.7	32.7	2442	0.047	0.007	PIEZ1_CAEEL Piezo-type mechanosensitive ion channel component 1 OS=Caenorhabditis elegans OX=6239 GN=pezo-1 PE=1 SV=1
19	P59511	2.7	32.7	1906	0.036	0.007	ATS20_MOUSE A disintegrin and metalloproteinase with thrombospondin motifs 20 OS=Mus musculus OX=10090 GN=Adamts20 PE=2 SV=2
20	P97814	2.9	32.3	415	0.068	0.063	PPIP1_MOUSE Proline-serine-threonine phosphatase-interacting protein 1 OS=Mus musculus OX=10090 GN=Pstpip1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15412 Nse4-Nse3_bdg	4.4e-09	47.6	Binding domain of Nse4/EID3 to Nse3-MAGE
2	PF08743 Nse4_C	1.2e-24	97.7	Nse4 C-terminal
3	PF04136 Sec34	3.4e+02	12.5	Sec34-like family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000358019

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000354957	0.999	Structural maintenance of chromosomes protein 5
2	9606.ENSP00000404092	0.999	Structural maintenance of chromosomes protein 6
3	9606.ENSP00000330694	0.998	Non-structural maintenance of chromosomes element 3 homolog
4	9606.ENSP00000355077	0.998	Non-structural maintenance of chromosomes element 1 homolog
5	9606.ENSP00000287437	0.991	E3 SUMO-protein ligase NSE2
6	9606.ENSP00000354720	0.961	Structural maintenance of chromosomes protein 3
7	9606.ENSP00000297338	0.945	Double-strand-break repair protein rad21 homolog
8	9606.ENSP00000323421	0.938	Structural maintenance of chromosomes protein 1A
9	9606.ENSP00000318635	0.924	Small ubiquitin-related modifier 4
10	9606.ENSP00000376077	0.922	Small ubiquitin-related modifier 1
11	9606.ENSP00000348056	0.918	SUMO-conjugating enzyme UBC9
12	9606.ENSP00000218089	0.912	Cohesin subunit SA-2
13	9606.ENSP00000372689	0.911	Cohesin subunit SA-1
14	9606.ENSP00000435619	0.905	EP300-interacting inhibitor of differentiation 3
15	9606.ENSP00000421861	0.821	Melanoma antigen family D, 4B
16	9606.ENSP00000472118	0.820	Melanoma-associated antigen D4
17	9606.ENSP00000315064	0.799	Melanoma-associated antigen F1
18	9606.ENSP00000317564	0.770	EP300-interacting inhibitor of differentiation 2B
19	9606.ENSP00000349085	0.768	Melanoma-associated antigen 1
20	9606.ENSP00000301744	0.757	Zinc finger protein 597

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.997	regulation of cellular process
GO:0080135	0.953	regulation of cellular response to stress
GO:0048522	0.948	positive regulation of cellular process
GO:2001020	0.943	regulation of response to DNA damage stimulus
GO:2001022	0.907	positive regulation of response to DNA damage stimulus
GO:0009987	0.706	cellular process
GO:0071704	0.602	organic substance metabolic process
GO:0044238	0.564	primary metabolic process
GO:0006807	0.549	nitrogen compound metabolic process
GO:0043170	0.519	macromolecule metabolic process
GO:0050896	0.453	response to stimulus
GO:0044237	0.331	cellular metabolic process
GO:0051716	0.319	cellular response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0000793	0.996	condensed chromosome
GO:0106068	0.995	SUMO ligase complex
GO:0016604	0.992	nuclear body
GO:0030915	0.985	Smc5-Smc6 complex
GO:0005737	0.598	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]