StarFunc result for job id Q9NY15

User Input

>input (2570 residues)
MAGPRGLLPLCLLAFCLAGFSFVRGQVLFKGCDVKTTFVTHVPCTSCAAIKKQTCPSGWL
RELPDQITQDCRYEVQLGGSMVSMSGCRRKCRKQVVQKACCPGYWGSRCHECPGGAETPC
NGHGTCLDGMDRNGTCVCQENFRGSACQECQDPNRFGPDCQSVCSCVHGVCNHGPRGDGS
CLCFAGYTGPHCDQELPVCQELRCPQNTQCSAEAPSCRCLPGYTQQGSECRAPNPCWPSP
CSLLAQCSVSPKGQAQCHCPENYHGDGMVCLPKDPCTDNLGGCPSNSTLCVYQKPGQAFC
TCRPGLVSINSNASAGCFAFCSPFSCDRSATCQVTADGKTSCVCRESEVGDGRACYGHLL
HEVQKATQTGRVFLQLRVAVAMMDQGCREILTTAGPFTVLVPSVSSFSSRTMNASLAQQL
CRQHIIAGQHILEDTRTQQTRRWWTLAGQEITVTFNQFTKYSYKYKDQPQQTFNIYKANN
IAANGVFHVVTGLRWQAPSGTPGDPKRTIGQILASTEAFSRFETILENCGLPSILDGPGP
FTVFAPSNEAVDSLRDGRLIYLFTAGLSKLQELVRYHIYNHGQLTVEKLISKGRILTMAN
QVLAVNISEEGRILLGPEGVPLQRVDVMAANGVIHMLDGILLPPTILPILPKHCSEEQHK
IVAGSCVDCQALNTSTCPPNSVKLDIFPKECVYIHDPTGLNVLKKGCASYCNQTIMEQGC
CKGFFGPDCTQCPGGFSNPCYGKGNCSDGIQGNGACLCFPDYKGIACHICSNPNKHGEQC
QEDCGCVHGLCDNRPGSGGVCQQGTCAPGFSGRFCNESMGDCGPTGLAQHCHLHARCVSQ
EGVARCRCLDGFEGDGFSCTPSNPCSHPDRGGCSENAECVPGSLGTHHCTCHKGWSGDGR
VCVAIDECELDMRGGCHTDALCSYVGPGQSRCTCKLGFAGDGYQCSPIDPCRAGNGGCHG
LATCRAVGGGQRVCTCPPGFGGDGFSCYGDIFRELEANAHFSIFYQWLKSAGITLPADRR
VTALVPSEAAVRQLSPEDRAFWLQPRTLPNLVRAHFLQGALFEEELARLGGQEVATLNPT
TRWEIRNISGRVWVQNASVDVADLLATNGVLHILSQVLLPPRGDVPGGQGLLQQLDLVPA
FSLFRELLQHHGLVPQIEAATAYTIFVPTNRSLEAQGNSSHLDADTVRHHVVLGEALSME
TLRKGGHRNSLLGPAHWIVFYNHSGQPEVNHVPLEGPMLEAPGRSLIGLSGVLTVGSSRC
LHSHAEALREKCVNCTRRFRCTQGFQLQDTPRKSCVYRSGFSFSRGCSYTCAKKIQVPDC
CPGFFGTLCEPCPGGLGGVCSGHGQCQDRFLGSGECHCHEGFHGTACEVCELGRYGPNCT
GVCDCAHGLCQEGLQGDGSCVCNVGWQGLRCDQKITSPQCPRKCDPNANCVQDSAGASTC
ACAAGYSGNGIFCSEVDPCAHGHGGCSPHANCTKVAPGQRTCTCQDGYMGDGELCQEINS
CLIHHGGCHIHAECIPTGPQQVSCSCREGYSGDGIRTCELLDPCSKNNGGCSPYATCKST
GDGQRTCTCDTAHTVGDGLTCRARVGLELLRDKHASFFSLRLLEYKELKGDGPFTIFVPH
ADLMSNLSQDELARIRAHRQLVFRYHVVGCRRLRSEDLLEQGYATALSGHPLRFSEREGS
IYLNDFARVVSSDHEAVNGILHFIDRVLLPPEALHWEPDDAPIPRRNVTAAAQGFGYKIF
SGLLKVAGLLPLLREASHRPFTMLWPTDAAFRALPPDRQAWLYHEDHRDKLAAILRGHMI
RNVEALASDLPNLGPLRTMHGTPISFSCSRTRAGELMVGEDDARIVQRHLPFEGGLAYGI
DQLLEPPGLGARCDHFETRPLRLNTCSICGLEPPCPEGSQEQGSPEACWRFYPKFWTSPP
LHSLGLRSVWVHPSLWGRPQGLGRGCHRNCVTTTWKPSCCPGHYGSECQACPGGPSSPCS
DRGVCMDGMSGSGQCLCRSGFAGTACELCAPGAFGPHCQACRCTVHGRCDEGLGGSGSCF
CDEGWTGPRCEVQLELQPVCTPPCAPEAVCRAGNSCECSLGYEGDGRVCTVADLCQDGHG
GCSEHANCSQVGTMVTCTCLPDYEGDGWSCRARNPCTDGHRGGCSEHANCLSTGLNTRRC
ECHAGYVGDGLQCLEESEPPVDRCLGQPPPCHSDAMCTDLHFQEKRAGVFHLQATSGPYG
LNFSEAEAACEAQGAVLASFPQLSAAQQLGFHLCLMGWLANGSTAHPVVFPVADCGNGRV
GIVSLGARKNLSERWDAYCFRVQDVACRCRNGFVGDGISTCNGKLLDVLAATANFSTFYG
MLLGYANATQRGLDFLDFLDDELTYKTLFVPVNEGFVDNMTLSGPDLELHASNATLLSAN
ASQGKLLPAHSGLSLIISDAGPDNSSWAPVAPGTVVVSRIIVWDIMAFNGIIHALASPLL
APPQPQAVLAPEAPPVAAGVGAVLAAGALLGLVAGALYLRARGKPMGFGFSAFQAEDDAD
DDFSPWQEGTNPTLVSVPNPVFGSDTFCEPFDDSLLEEDFPDTQRILTVK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:E0CZJ3	0.290	0.292	0.000	2553	0.407	0.410	E0CZJ3.pdb.gz	E0CZJ3_DANRE FEEL-1 OS=Danio rerio OX=7955 GN=FEEL-1 PE=1 SV=1
2	AFDB:F6P8Y7	0.283	0.286	0.000	2543	0.384	0.389	F6P8Y7.pdb.gz	F6P8Y7_DANRE Stabilin 2 OS=Danio rerio OX=7955 GN=si:dkey-207j16.6 PE=1 SV=1
3	AFDB:Q8CFM6	0.292	0.466	0.000	1431	0.220	0.396	Q8CFM6.pdb.gz	STAB2_RAT Stabilin-2 (Fragment) OS=Rattus norvegicus OX=10116 GN=Stab2 PE=1 SV=1
4	AFDB:Q8R4U0	0.202	0.203	0.000	2559	0.401	0.403	Q8R4U0.pdb.gz	STAB2_MOUSE Stabilin-2 OS=Mus musculus OX=10090 GN=Stab2 PE=1 SV=1
5	AFDB:Q8WWQ8	0.226	0.227	0.000	2551	0.409	0.412	Q8WWQ8.pdb.gz	STAB2_HUMAN Stabilin-2 OS=Homo sapiens OX=9606 GN=STAB2 PE=1 SV=3
6	AFDB:Q9NY15	1.000	1.000	0.000	2570	1.000	1.000	Q9NY15.pdb.gz	STAB1_HUMAN Stabilin-1 OS=Homo sapiens OX=9606 GN=STAB1 PE=1 SV=3
7	AFDB:A8KBK2	0.107	0.337	3.657E-51	659	0.100	0.388	A8KBK2.pdb.gz
8	AFDB:A0A140LGI0	0.044	0.091	5.135E-15	1176	0.058	0.127	A0A140LGI0.pdb.gz
9	AFDB:P07522	0.044	0.088	8.976E-13	1133	0.056	0.127	P07522.pdb.gz	EGF_RAT Pro-epidermal growth factor OS=Rattus norvegicus OX=10116 GN=Egf PE=1 SV=2
10	AFDB:P01132	0.043	0.085	1.351E-12	1217	0.057	0.121	P01132.pdb.gz	EGF_MOUSE Pro-epidermal growth factor OS=Mus musculus OX=10090 GN=Egf PE=1 SV=2
11	PDB:7q3nU	0.034	0.198	4.091E-7	292	0.025	0.223	7q3nU.pdb.gz	Structure of the decoy module of human glycoprotein 2 and uromodulin and its interaction with bacterial adhesin FimH.
12	PDB:1nyoA	0.046	0.641	1.543E-5	163	0.012	0.190	1nyoA.pdb.gz
13	PDB:4g1eB	0.029	0.073	3.144E-3	709	0.024	0.086	4g1eB.pdb.gz	AlphaV Beta3 Integrin Crystal Structures and their Functional Implications
14	PDB:5es4B	0.027	0.052	1.019E-2	674	0.021	0.079	5es4B.pdb.gz	Leukocyte integrin alpha L beta 2 headpiece structures: The alpha I domain, the pocket for the internal ligand, and concerted movements of its loops.
15	PDB:1u8cB	0.027	0.096	6.099E-2	599	0.014	0.058	1u8cB.pdb.gz	A novel adaptation of the integrin PSI domain revealed from its crystal structure.
16	PDB:7nxdB	0.026	0.062	9.182E-2	690	0.016	0.061	7nxdB.pdb.gz	Structural insights into integrin alpha 5 beta 1 opening by fibronectin ligand.
17	PDB:4e0sB	0.025	0.059	1.977E-1	898	0.015	0.042	4e0sB.pdb.gz	Crystal structure of c5b-6 suggests structural basis for priming assembly of the membrane attack complex.
18	PDB:5nqkB	0.016	0.104	9.164E-1	242	0.005	0.058	5nqkB.pdb.gz	human 199.16 TCR in complex with Melan-A/MART-1 (26-35) peptide and HLA-A2
19	PDB:4rs0A	0.015	0.066	9.645E-1	557	0.006	0.027	4rs0A.pdb.gz	Action at a Distance: MUTATIONS OF PERIPHERAL RESIDUES TRANSFORM RAPID REVERSIBLE INHIBITORS TO SLOW, TIGHT BINDERS OF CYCLOOXYGENASE-2.
20	PDB:6pwnA	0.017	0.076	1.245	280	0.007	0.061	6pwnA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	C6GHV6	0.0	1694	2508	0.379	0.389	C6GHV6_DANRE Stabilin 2 OS=Danio rerio OX=7955 GN=si:dkey-207j16.6 PE=1 SV=1
2	E0CZJ3	0.0	1955	2553	0.408	0.410	E0CZJ3_DANRE FEEL-1 OS=Danio rerio OX=7955 GN=FEEL-1 PE=1 SV=1
3	F6P8Y7	0.0	1789	2543	0.388	0.392	F6P8Y7_DANRE Stabilin 2 OS=Danio rerio OX=7955 GN=si:dkey-207j16.6 PE=1 SV=1
4	Q8CFM6	0.0	1028	1431	0.221	0.396	STAB2_RAT Stabilin-2 (Fragment) OS=Rattus norvegicus OX=10116 GN=Stab2 PE=1 SV=1
5	Q8R4U0	0.0	1883	2559	0.402	0.403	STAB2_MOUSE Stabilin-2 OS=Mus musculus OX=10090 GN=Stab2 PE=1 SV=1
6	Q8WWQ8	0.0	1944	2551	0.407	0.410	STAB2_HUMAN Stabilin-2 OS=Homo sapiens OX=9606 GN=STAB2 PE=1 SV=3
7	Q9NY15	0.0	5244	2570	1.000	1.000	STAB1_HUMAN Stabilin-1 OS=Homo sapiens OX=9606 GN=STAB1 PE=1 SV=3
8	P98066	8.40e-28	117	277	0.019	0.181	TSG6_HUMAN Tumor necrosis factor-inducible gene 6 protein OS=Homo sapiens OX=9606 GN=TNFAIP6 PE=1 SV=2
9	B0BN34	2.95e-27	115	275	0.019	0.178	B0BN34_RAT TNF alpha induced protein 6 OS=Rattus norvegicus OX=10116 GN=Tnfaip6 PE=4 SV=1
10	O08859	3.44e-27	115	275	0.019	0.178	TSG6_MOUSE Tumor necrosis factor-inducible gene 6 protein OS=Mus musculus OX=10090 GN=Tnfaip6 PE=1 SV=1
11	O70244	2.57e-19	99.0	3623	0.035	0.025	CUBN_RAT Cubilin OS=Rattus norvegicus OX=10116 GN=Cubn PE=1 SV=2
12	Q9JLB4	1.45e-18	96.3	3623	0.035	0.025	CUBN_MOUSE Cubilin OS=Mus musculus OX=10090 GN=Cubn PE=1 SV=3
13	O60494	3.61e-16	88.6	3623	0.046	0.032	CUBN_HUMAN Cubilin OS=Homo sapiens OX=9606 GN=CUBN PE=1 SV=5
14	Q9TU53	5.85e-15	84.3	3620	0.033	0.023	CUBN_CANLF Cubilin OS=Canis lupus familiaris OX=9615 GN=CUBN PE=1 SV=1
15	Q9VTP0	2.58e-14	82.4	3613	0.033	0.024	Q9VTP0_DROME Cubulin 2 OS=Drosophila melanogaster OX=7227 GN=Cubn2 PE=4 SV=4
16	B8JI71	7.29e-14	80.9	2904	0.035	0.031	EYS_DANRE Protein eyes shut homolog OS=Danio rerio OX=7955 GN=eys PE=1 SV=2
17	Q9GZV7	1.35e-13	77.0	340	0.016	0.121	HPLN2_HUMAN Hyaluronan and proteoglycan link protein 2 OS=Homo sapiens OX=9606 GN=HAPLN2 PE=1 SV=1
18	M9NCR4	1.37e-13	80.1	15105	0.030	0.005	M9NCR4_DROME Dumpy, isoform J OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
19	M9PCJ8	1.63e-13	79.7	14825	0.030	0.005	M9PCJ8_DROME Dumpy, isoform X OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
20	M9NER8	1.68e-13	79.7	15638	0.030	0.005	M9NER8_DROME Dumpy, isoform I OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12662 cEGF	4.5	18.6	Complement Clr-like EGF-like
2	PF12947 EGF_3	3e-51	182.6	EGF domain
3	PF12946 EGF_MSP1_1	0.89	20.9	MSP1 EGF domain 1
4	PF02469 Fasciclin	4.5e-94	322.8	Fasciclin domain
5	PF14670 FXa_inhibition	17	17.1	Coagulation Factor Xa inhibitory site
6	PF00193 Xlink	1.1e-24	97.8	Extracellular link domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000312946

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000398722	0.924	Chitinase domain-containing protein 1
2	9606.ENSP00000233575	0.852	Sorting nexin-17
3	9606.ENSP00000231061	0.784	SPARC
4	9606.ENSP00000363773	0.756	Complement C1q subcomponent subunit A
5	9606.ENSP00000304236	0.742	Monocyte differentiation antigen CD14
6	9606.ENSP00000352071	0.739	Scavenger receptor cysteine-rich type 1 protein M130
7	9606.ENSP00000313967	0.735	Complement C1q subcomponent subunit B
8	9606.ENSP00000455897	0.706	Macrophage mannose receptor 1
9	9606.ENSP00000263071	0.704	Scavenger receptor class F member 1
10	9606.ENSP00000298223	0.701	Folate receptor beta
11	9606.ENSP00000363770	0.698	Complement C1q subcomponent subunit C
12	9606.ENSP00000264870	0.677	Coagulation factor XIII A chain
13	9606.ENSP00000363869	0.650	V-set and immunoglobulin domain-containing protein 4
14	9606.ENSP00000286301	0.646	Macrophage colony-stimulating factor 1 receptor
15	9606.ENSP00000352601	0.641	Low-density lipoprotein receptor-related protein 10
16	9606.ENSP00000233242	0.640	Apolipoprotein B-100
17	9606.ENSP00000265440	0.598	Transcription factor EC
18	9606.ENSP00000262629	0.588	TYRO protein tyrosine kinase-binding protein
19	9606.ENSP00000311962	0.581	ADP-ribosylation factor-binding protein GGA2
20	9606.ENSP00000392770	0.576	Membrane-spanning 4-domains subfamily A member 6A

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005044	1.000	scavenger receptor activity
GO:0030169	1.000	low-density lipoprotein particle binding
GO:0005041	0.999	low-density lipoprotein particle receptor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.990	regulation of biological process
GO:0009987	0.983	cellular process
GO:0050896	0.980	response to stimulus
GO:0006898	0.933	receptor-mediated endocytosis
GO:0050793	0.835	regulation of developmental process
GO:0050794	0.834	regulation of cellular process
GO:0009605	0.792	response to external stimulus
GO:0006952	0.774	defense response
GO:0051241	0.769	negative regulation of multicellular organismal process
GO:0051707	0.744	response to other organism
GO:0007154	0.741	cell communication
GO:0023052	0.720	signaling
GO:2000181	0.693	negative regulation of blood vessel morphogenesis
GO:0045765	0.688	regulation of angiogenesis
GO:0016525	0.596	negative regulation of angiogenesis
GO:0048518	0.587	positive regulation of biological process
GO:0009617	0.472	response to bacterium
GO:0098542	0.460	defense response to other organism
GO:0042742	0.422	defense response to bacterium
GO:0007267	0.354	cell-cell signaling
GO:0048522	0.340	positive regulation of cellular process
GO:0051716	0.302	cellular response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0031410	0.999	cytoplasmic vesicle
GO:0098588	0.988	bounding membrane of organelle
GO:0030659	0.977	cytoplasmic vesicle membrane
GO:0012505	0.931	endomembrane system
GO:0030139	0.928	endocytic vesicle
GO:0030666	0.806	endocytic vesicle membrane
GO:0005576	0.378	extracellular region
GO:0005615	0.308	extracellular space

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]