StarFunc result for job id Q9NY30

User Input

>input (223 residues)
MRDEIATTVFFVTRLVKKHDKLSKQQIEDFAEKLMTILFETYRSHWHSDCPSKGQAFRCI
RINNNQNKDPILERACVESNVDFSHLGLPKEMTIWVDPFEVCCRYGEKNHPFTVASFKGR
WEEWELYQQISYAVSRASSDVSSGTSCDEESCSKEPRVIPKVSNPKSIYQVENLKQPFQS
WLQIPRKKNVVDGRVGLLGNTYHGSQKHPKCYRPAMHRLDRIL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9NY30	1.000	1.000	3.815E-38	223	1.000	1.000	Q9NY30.pdb.gz	BTG4_HUMAN Protein BTG4 OS=Homo sapiens OX=9606 GN=BTG4 PE=1 SV=1
2	AFDB:O70552	0.557	0.498	1.500E-29	250	0.726	0.648	O70552.pdb.gz	BTG4_MOUSE Protein BTG4 OS=Mus musculus OX=10090 GN=Btg4 PE=1 SV=2
3	AFDB:O88677	0.534	0.473	1.506E-20	252	0.462	0.409	O88677.pdb.gz	BTG3_RAT Protein BTG3 OS=Rattus norvegicus OX=10116 GN=Btg3 PE=2 SV=1
4	AFDB:Q7SZR1	0.511	0.358	1.003E-11	322	0.256	0.177	Q7SZR1.pdb.gz	Q7SZR1_DANRE Protein Tob1 OS=Danio rerio OX=7955 GN=tob1 PE=2 SV=1
5	AFDB:Q61471	0.510	0.319	1.064E-11	362	0.251	0.155	Q61471.pdb.gz	TOB1_MOUSE Protein Tob1 OS=Mus musculus OX=10090 GN=Tob1 PE=1 SV=2
6	AFDB:P27049	0.491	0.687	1.603E-11	158	0.193	0.272	P27049.pdb.gz	BTG2_RAT Protein BTG2 OS=Rattus norvegicus OX=10116 GN=Btg2 PE=1 SV=1
7	AFDB:Q9VXJ9	0.502	0.203	1.802E-11	564	0.220	0.087	Q9VXJ9.pdb.gz	Q9VXJ9_DROME Transducer of ERBB2, isoform A OS=Drosophila melanogaster OX=7227 GN=Tob PE=3 SV=1
8	AFDB:P62324	0.485	0.627	1.910E-11	171	0.193	0.251	P62324.pdb.gz	BTG1_HUMAN Protein BTG1 OS=Homo sapiens OX=9606 GN=BTG1 PE=1 SV=1
9	AFDB:Q9JM55	0.504	0.329	2.148E-11	345	0.269	0.174	Q9JM55.pdb.gz	TOB2_MOUSE Protein Tob2 OS=Mus musculus OX=10090 GN=Tob2 PE=2 SV=1
10	AFDB:Q14106	0.503	0.330	2.277E-11	344	0.251	0.163	Q14106.pdb.gz	TOB2_HUMAN Protein Tob2 OS=Homo sapiens OX=9606 GN=TOB2 PE=1 SV=2
11	PDB:5ci8A	0.487	0.911	6.038E-11	117	0.175	0.333	5ci8A.pdb.gz	Structural basis for inhibition of the Tob-CNOT7 interaction by a fragment screening approach
12	PDB:3j79V	0.136	0.180	1.273	155	0.081	0.116	3j79V.pdb.gz	Cryo-EM structure of the Plasmodium falciparum 80S ribosome bound to the anti-protozoan drug emetine.
13	PDB:6mbnA	0.157	0.148	1.517	241	0.063	0.058	6mbnA.pdb.gz	Combining Mutations That Inhibit Two Distinct Steps of the ATP Hydrolysis Cycle Restores Wild-Type Function in the Lipopolysaccharide Transporter and Shows that ATP Binding Triggers Transport.
14	PDB:6vq6I	0.099	0.099	1.609	225	0.103	0.102	6vq6I.pdb.gz	Structure of V-ATPase from the mammalian brain.
15	PDB:7r97A	0.165	0.163	2.033	226	0.090	0.088	7r97A.pdb.gz	Structural basis for Dicer-like function of an engineered RNase III variant and insights into the reaction trajectory of two-Mg 2+ -ion catalysis.
16	PDB:1iznA	0.102	0.084	2.156	275	0.045	0.036	1iznA.pdb.gz
17	PDB:6rkwD	0.107	0.047	2.424	781	0.067	0.019	6rkwD.pdb.gz	Cryo-EM structure of the complete E. coli DNA gyrase nucleoprotein complex.
18	PDB:1uchA	0.120	0.124	2.889	206	0.054	0.058	1uchA.pdb.gz
19	PDB:1jjwA	0.143	0.172	3.444	173	0.058	0.075	1jjwA.pdb.gz	Structure of Haemophilus influenzae HslV protein at 1.9 A resolution, revealing a cation-binding site near the catalytic site.
20	PDB:5fgiH	0.128	0.123	3.872	234	0.058	0.056	5fgiH.pdb.gz	A unified mechanism for proteolysis and autocatalytic activation in the 20S proteasome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9NY30	7.89e-171	470	223	1.000	1.000	BTG4_HUMAN Protein BTG4 OS=Homo sapiens OX=9606 GN=BTG4 PE=1 SV=1
2	O70552	4.30e-120	343	250	0.726	0.648	BTG4_MOUSE Protein BTG4 OS=Mus musculus OX=10090 GN=Btg4 PE=1 SV=2
3	P50615	2.42e-56	181	252	0.439	0.389	BTG3_MOUSE Protein BTG3 OS=Mus musculus OX=10090 GN=Btg3 PE=2 SV=1
4	O88677	3.17e-56	181	252	0.435	0.385	BTG3_RAT Protein BTG3 OS=Rattus norvegicus OX=10116 GN=Btg3 PE=2 SV=1
5	Q14201	4.67e-55	178	252	0.430	0.381	BTG3_HUMAN Protein BTG3 OS=Homo sapiens OX=9606 GN=BTG3 PE=1 SV=3
6	P78543	2.94e-21	88.2	158	0.211	0.297	BTG2_HUMAN Protein BTG2 OS=Homo sapiens OX=9606 GN=BTG2 PE=1 SV=1
7	P27049	9.24e-21	87.0	158	0.206	0.291	BTG2_RAT Protein BTG2 OS=Rattus norvegicus OX=10116 GN=Btg2 PE=1 SV=1
8	Q04211	2.66e-20	85.9	158	0.202	0.285	BTG2_MOUSE Protein BTG2 OS=Mus musculus OX=10090 GN=Btg2 PE=1 SV=1
9	Q63073	6.22e-20	85.1	171	0.184	0.240	BTG1_RAT Protein BTG1 OS=Rattus norvegicus OX=10116 GN=Btg1 PE=2 SV=1
10	P62324	7.36e-20	85.1	171	0.184	0.240	BTG1_HUMAN Protein BTG1 OS=Homo sapiens OX=9606 GN=BTG1 PE=1 SV=1
11	P62325	7.36e-20	85.1	171	0.184	0.240	BTG1_MOUSE Protein BTG1 OS=Mus musculus OX=10090 GN=Btg1 PE=1 SV=1
12	Q6IBC8	7.36e-20	85.1	171	0.184	0.240	Q6IBC8_HUMAN B-cell translocation gene 1, anti-proliferative OS=Homo sapiens OX=9606 GN=BTG1 PE=1 SV=1
13	Q7SZR1	6.54e-18	82.8	322	0.175	0.121	Q7SZR1_DANRE Protein Tob1 OS=Danio rerio OX=7955 GN=tob1 PE=2 SV=1
14	P50616	1.06e-17	82.4	345	0.175	0.113	TOB1_HUMAN Protein Tob1 OS=Homo sapiens OX=9606 GN=TOB1 PE=1 SV=1
15	Q61471	2.24e-17	81.6	362	0.170	0.105	TOB1_MOUSE Protein Tob1 OS=Mus musculus OX=10090 GN=Tob1 PE=1 SV=2
16	Q9VXJ9	7.00e-15	75.1	564	0.175	0.069	Q9VXJ9_DROME Transducer of ERBB2, isoform A OS=Drosophila melanogaster OX=7227 GN=Tob PE=3 SV=1
17	Q14106	1.85e-14	73.2	344	0.161	0.105	TOB2_HUMAN Protein Tob2 OS=Homo sapiens OX=9606 GN=TOB2 PE=1 SV=2
18	Q9JM55	2.01e-14	73.2	345	0.161	0.104	TOB2_MOUSE Protein Tob2 OS=Mus musculus OX=10090 GN=Tob2 PE=2 SV=1
19	Q54NU5	3.04e-06	49.3	423	0.126	0.066	BTG_DICDI BTG family protein OS=Dictyostelium discoideum OX=44689 GN=btg PE=3 SV=1
20	Q8LGU6	7.3	30.0	744	0.063	0.019	CD27B_ARATH Cell division cycle protein 27 homolog B OS=Arabidopsis thaliana OX=3702 GN=CDC27B PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07742 BTG	2.7e-37	138.4	BTG family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000348300

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000437289	0.903	ZAR1-like protein
2	9606.ENSP00000355279	0.863	CCR4-NOT transcription complex subunit 7
3	9606.ENSP00000329803	0.733	Zygote arrest protein 1
4	9606.ENSP00000252677	0.731	Bone morphogenetic protein 15
5	9606.ENSP00000380675	0.719	Wee1-like protein kinase 2
6	9606.ENSP00000430493	0.710	CCR4-NOT transcription complex subunit 8
7	9606.ENSP00000424896	0.674	CCR4-NOT transcription complex subunit 6-like
8	9606.ENSP00000229307	0.636	Homeobox protein NANOG
9	9606.ENSP00000223642	0.627	Complement C5
10	9606.ENSP00000477715	0.588	Cytoplasmic polyadenylation element-binding protein 1
11	9606.ENSP00000402084	0.586	Wee1-like protein kinase
12	9606.ENSP00000411397	0.581	MAP/microtubule affinity-regulating kinase 3
13	9606.ENSP00000377024	0.574	CCR4-NOT transcription complex subunit 6
14	9606.ENSP00000310722	0.573	Belongs to the protein kinase superfamily. Ser/Thr protein kinase family
15	9606.ENSP00000299367	0.571	Complement C2
16	9606.ENSP00000425561	0.551	Eukaryotic translation initiation factor 4E
17	9606.ENSP00000238714	0.531	Poly(A) polymerase gamma
18	9606.ENSP00000263187	0.530	MutS protein homolog 4
19	9606.ENSP00000258317	0.511	N-acetylneuraminate lyase
20	9606.ENSP00000371294	0.511	Cystinosin

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:1901363	0.324	heterocyclic compound binding
GO:0097159	0.324	organic cyclic compound binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.998	regulation of cellular process
GO:0009987	0.985	cellular process
GO:0048519	0.975	negative regulation of biological process
GO:0048523	0.969	negative regulation of cellular process
GO:0042127	0.939	regulation of cell population proliferation
GO:0032502	0.910	developmental process
GO:0051726	0.890	regulation of cell cycle
GO:0032501	0.821	multicellular organismal process
GO:0048856	0.568	anatomical structure development
GO:0008285	0.499	negative regulation of cell population proliferation
GO:0007275	0.486	multicellular organism development
GO:0019222	0.423	regulation of metabolic process
GO:0030154	0.404	cell differentiation
GO:0022008	0.384	neurogenesis
GO:0060255	0.336	regulation of macromolecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043231	0.998	intracellular membrane-bounded organelle
GO:0005634	0.961	nucleus
GO:0005829	0.461	cytosol
GO:0031981	0.424	nuclear lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]