StarFunc result for job id Q9NY43

User Input

>input (387 residues)
MTMEGASGSSFGIDTILSSASSGSPGMMNGDFRPLGEARTADFRSQATPSPCSEIDTVGT
APSSPISVTMEPPEPHLVADATQHHHHLHHSQQPPPPAAAPTQSLQPLPQQQQPLPPQQP
PPPPPQQLGSAASAPRTSTSSFLIKDILGDSKPLAACAPYSTSVSSPHHTPKQESNAVHE
SFRPKLEQEDSKTKLDKREDSQSDIKCHGTKEEGDREITSSRESPPVRAKKPRKARTAFS
DHQLNQLERSFERQKYLSVQDRMDLAAALNLTDTQVKTWYQNRRTKWKRQTAVGLELLAE
AGNYSALQRMFPSPYFYHPSLLGSMDSTTAAAAAAAMYSSMYRTPPAPHPQLQRPLVPRV
LIHGLGPGGQPALNPLSSPIPGTPHPR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9NY43	0.999	0.999	5.235E-54	387	1.000	1.000	Q9NY43.pdb.gz	BARH2_HUMAN BarH-like 2 homeobox protein OS=Homo sapiens OX=9606 GN=BARHL2 PE=1 SV=2
2	AFDB:A5JNG8	0.181	0.182	3.152E-7	384	0.186	0.188	A5JNG8.pdb.gz	A5JNG8_DANRE Nanog OS=Danio rerio OX=7955 GN=fd20a07 PE=2 SV=1
3	AFDB:Q01822	0.161	0.188	1.786E-6	328	0.189	0.223	Q01822.pdb.gz	HXD1_MOUSE Homeobox protein Hox-D1 OS=Mus musculus OX=10090 GN=Hoxd1 PE=2 SV=2
4	AFDB:P82976	0.155	0.145	2.462E-6	418	0.217	0.201	P82976.pdb.gz	GBX1_MOUSE Homeobox protein GBX-1 OS=Mus musculus OX=10090 GN=Gbx1 PE=2 SV=2
5	AFDB:P09085	0.162	0.147	2.985E-6	427	0.194	0.176	P09085.pdb.gz	CAD_DROME Homeotic protein caudal OS=Drosophila melanogaster OX=7227 GN=cad PE=1 SV=4
6	AFDB:P31276	0.168	0.194	8.341E-6	330	0.178	0.209	P31276.pdb.gz	HXC13_HUMAN Homeobox protein Hox-C13 OS=Homo sapiens OX=9606 GN=HOXC13 PE=1 SV=3
7	AFDB:P10105	0.163	0.102	3.654E-5	635	0.222	0.135	P10105.pdb.gz	LAB_DROME Homeotic protein labial OS=Drosophila melanogaster OX=7227 GN=lab PE=1 SV=2
8	AFDB:P31275	0.170	0.230	8.982E-5	282	0.155	0.213	P31275.pdb.gz	HXC12_HUMAN Homeobox protein Hox-C12 OS=Homo sapiens OX=9606 GN=HOXC12 PE=3 SV=2
9	AFDB:Q5U1D9	0.177	0.090	1.941E-4	837	0.186	0.086	Q5U1D9.pdb.gz	Q5U1D9_DROME SD09647p OS=Drosophila melanogaster OX=7227 GN=Vsx1 PE=2 SV=1
10	AFDB:Q62036	0.102	0.046	3.973E-3	1060	0.176	0.064	Q62036.pdb.gz	CP131_MOUSE Centrosomal protein of 131 kDa OS=Mus musculus OX=10090 GN=Cep131 PE=1 SV=2
11	PDB:4egcA	0.131	0.094	1.412E-2	539	0.044	0.032	4egcA.pdb.gz	Structure-function analyses of the human SIX1-EYA2 complex reveal insights into metastasis and BOR syndrome.
12	PDB:2hi3A	0.130	0.624	3.947E-2	73	0.036	0.192	2hi3A.pdb.gz
13	PDB:7fbyA	0.101	0.232	4.832E-1	153	0.023	0.059	7fbyA.pdb.gz	Crystal Structure of PH0140 from Pyrococcus horikosii OT3
14	PDB:5mymC	0.130	0.221	1.188	205	0.047	0.088	5mymC.pdb.gz	Target Identification of Mycobacterium tuberculosis Phenotypic Hits Using a Concerted Chemogenomic, Biophysical, and Structural Approach.
15	PDB:5nr5A	0.101	0.312	1.536	113	0.044	0.150	5nr5A.pdb.gz
16	PDB:5aj0BZ	0.110	0.419	2.737	86	0.016	0.070	5aj0BZ.pdb.gz	Structural Snapshots of Actively Translating Human Ribosomes
17	PDB:2cg4A	0.086	0.211	3.112	149	0.018	0.047	2cg4A.pdb.gz	Structural Insight Into Gene Transcriptional Regulation and Effector Binding by the Lrp/Asnc Family.
18	PDB:3s5wB	0.070	0.066	3.319	414	0.021	0.019	3s5wB.pdb.gz	Two Structures of an N-Hydroxylating Flavoprotein Monooxygenase: ORNITHINE HYDROXYLASE FROM PSEUDOMONAS AERUGINOSA.
19	PDB:2cjjA	0.121	0.628	3.774	63	0.026	0.159	2cjjA.pdb.gz
20	PDB:2vbwA	0.106	0.262	4.024	147	0.021	0.054	2vbwA.pdb.gz	Mechanistic Insights from the Crystal Structures of a Feast/Famine Regulatory Protein from Mycobacterium Tuberculosis H37Rv.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O88181	0.0	642	384	0.925	0.932	BARH2_RAT BarH-like 2 homeobox protein OS=Rattus norvegicus OX=10116 GN=Barhl2 PE=2 SV=1
2	Q8VIB5	0.0	664	384	0.925	0.932	BARH2_MOUSE BarH-like 2 homeobox protein OS=Mus musculus OX=10090 GN=Barhl2 PE=2 SV=2
3	Q9NY43	0.0	784	387	1.000	1.000	BARH2_HUMAN BarH-like 2 homeobox protein OS=Homo sapiens OX=9606 GN=BARHL2 PE=1 SV=2
4	Q9BZE3	2.71e-99	300	327	0.504	0.596	BARH1_HUMAN BarH-like 1 homeobox protein OS=Homo sapiens OX=9606 GN=BARHL1 PE=2 SV=1
5	P63157	6.26e-98	296	327	0.512	0.606	BARH1_MOUSE BarH-like 1 homeobox protein OS=Mus musculus OX=10090 GN=Barhl1 PE=2 SV=1
6	Q24255	1.89e-39	149	544	0.194	0.138	BARH1_DROME Homeobox protein B-H1 OS=Drosophila melanogaster OX=7227 GN=B-H1 PE=2 SV=2
7	Q24256	4.92e-39	149	645	0.178	0.107	BARH2_DROME Homeobox protein B-H2 OS=Drosophila melanogaster OX=7227 GN=B-H2 PE=1 SV=3
8	Q22909	2.36e-35	131	237	0.160	0.262	HM30_CAEEL Homeobox protein ceh-30 OS=Caenorhabditis elegans OX=6239 GN=ceh-30 PE=2 SV=2
9	Q9UMQ3	2.26e-21	95.1	279	0.111	0.154	BARX2_HUMAN Homeobox protein BarH-like 2 OS=Homo sapiens OX=9606 GN=BARX2 PE=1 SV=3
10	O08686	3.04e-21	94.7	283	0.111	0.152	BARX2_MOUSE Homeobox protein BarH-like 2 OS=Mus musculus OX=10090 GN=Barx2 PE=2 SV=2
11	Q504H8	6.38e-21	94.0	297	0.137	0.178	HMX3_DANRE Homeobox protein HMX3 OS=Danio rerio OX=7955 GN=hmx3 PE=2 SV=1
12	Q9ER42	3.08e-20	91.3	254	0.114	0.173	BARX1_MOUSE Homeobox protein BarH-like 1 OS=Mus musculus OX=10090 GN=Barx1 PE=2 SV=1
13	A9Y2A9	6.71e-20	90.9	282	0.147	0.202	A9Y2A9_DANRE Homeobox protein HMX1 OS=Danio rerio OX=7955 GN=Nkx5-3 PE=2 SV=1
14	P42581	6.96e-20	92.0	356	0.127	0.138	HMX3_MOUSE Homeobox protein HMX3 OS=Mus musculus OX=10090 GN=Hmx3 PE=1 SV=3
15	O70218	6.21e-19	89.0	332	0.119	0.139	HMX1_MOUSE Homeobox protein HMX1 OS=Mus musculus OX=10090 GN=Hmx1 PE=2 SV=1
16	Q503F2	9.51e-19	87.0	248	0.098	0.153	BARX1_DANRE Homeobox protein BarH-like 1 OS=Danio rerio OX=7955 GN=barx1 PE=2 SV=2
17	G3UXB3	1.16e-18	89.4	440	0.096	0.084	NKX11_MOUSE NK1 transcription factor-related protein 1 OS=Mus musculus OX=10090 GN=Nkx1-1 PE=2 SV=2
18	P42580	2.19e-18	87.0	305	0.096	0.121	NKX12_MOUSE NK1 transcription factor-related protein 2 OS=Mus musculus OX=10090 GN=Nkx1-2 PE=1 SV=1
19	P43345	2.23e-18	87.4	332	0.109	0.127	TLX1_MOUSE T-cell leukemia homeobox protein 1 OS=Mus musculus OX=10090 GN=Tlx1 PE=1 SV=1
20	F1R2J1	2.75e-18	84.0	182	0.134	0.286	PNX_DANRE Homeobox protein pnx OS=Danio rerio OX=7955 GN=pnx PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00046 Homeodomain	6.8e-18	75.6	Homeodomain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000359474

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000318799	0.780	Class E basic helix-loop-helix protein 22
2	9606.ENSP00000362777	0.749	Protein atonal homolog 7
3	9606.ENSP00000299162	0.728	Forkhead box protein N4
4	9606.ENSP00000365687	0.658	Pancreas transcription factor 1 subunit alpha
5	9606.ENSP00000242994	0.640	Neurogenic differentiation factor 4
6	9606.ENSP00000281321	0.623	POU domain, class 4, transcription factor 2
7	9606.ENSP00000295108	0.583	Neurogenic differentiation factor 1
8	9606.ENSP00000477829	0.558	LIM/homeobox protein Lhx1
9	9606.ENSP00000356357	0.549	LIM/homeobox protein Lhx9
10	9606.ENSP00000352162	0.542	ELAV-like protein 3
11	9606.ENSP00000434364	0.532	Sodium- and chloride-dependent glycine transporter 2
12	9606.ENSP00000230658	0.529	Insulin gene enhancer protein ISL-1
13	9606.ENSP00000386499	0.521	Proline-rich protein 35
14	9606.ENSP00000261731	0.514	LIM/homeobox protein Lhx5
15	9606.ENSP00000455711	0.504	Transcriptional repressor scratch 1
16	9606.ENSP00000314480	0.501	Homeobox protein unc-4 homolog

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:1990837	1.000	sequence-specific double-stranded DNA binding
GO:0005515	0.999	protein binding
GO:0000981	0.999	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0000976	0.511	transcription cis-regulatory region binding
GO:0000977	0.327	RNA polymerase II transcription regulatory region sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.998	regulation of biological process
GO:0019222	0.992	regulation of metabolic process
GO:0050794	0.989	regulation of cellular process
GO:0032501	0.981	multicellular organismal process
GO:0032502	0.977	developmental process
GO:0009889	0.975	regulation of biosynthetic process
GO:0048856	0.968	anatomical structure development
GO:0051171	0.960	regulation of nitrogen compound metabolic process
GO:0080090	0.959	regulation of primary metabolic process
GO:0007275	0.957	multicellular organism development
GO:0010556	0.956	regulation of macromolecule biosynthetic process
GO:0031326	0.956	regulation of cellular biosynthetic process
GO:0051252	0.945	regulation of RNA metabolic process
GO:0007399	0.942	nervous system development
GO:0006357	0.938	regulation of transcription by RNA polymerase II
GO:0009987	0.917	cellular process
GO:0050793	0.604	regulation of developmental process
GO:0048513	0.490	animal organ development
GO:0048518	0.465	positive regulation of biological process
GO:0048522	0.430	positive regulation of cellular process
GO:0048519	0.340	negative regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0070013	0.436	intracellular organelle lumen
GO:0031981	0.354	nuclear lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]