StarFunc result for job id Q9NY46

User Input

>input (2000 residues)
MAQALLVPPGPESFRLFTRESLAAIEKRAAEEKAKKPKKEQDNDDENKPKPNSDLEAGKN
LPFIYGDIPPEMVSEPLEDLDPYYINKKTFIVMNKGKAIFRFSATSALYILTPLNPVRKI
AIKILVHSLFSMLIMCTILTNCVFMTLSNPPDWTKNVEYTFTGIYTFESLIKILARGFCL
EDFTFLRDPWNWLDFSVIVMAYVTEFVSLGNVSALRTFRVLRALKTISVIPGLKTIVGAL
IQSVKKLSDVMILTVFCLSVFALIGLQLFMGNLRNKCLQWPPSDSAFETNTTSYFNGTMD
SNGTFVNVTMSTFNWKDYIGDDSHFYVLDGQKDPLLCGNGSDAGQCPEGYICVKAGRNPN
YGYTSFDTFSWAFLSLFRLMTQDYWENLYQLTLRAAGKTYMIFFVLVIFLGSFYLVNLIL
AVVAMAYEEQNQATLEEAEQKEAEFQQMLEQLKKQQEEAQAVAAASAASRDFSGIGGLGE
LLESSSEASKLSSKSAKEWRNRRKKRRQREHLEGNNKGERDSFPKSESEDSVKRSSFLFS
MDGNRLTSDKKFCSPHQSLLSIRGSLFSPRRNSKTSIFSFRGRAKDVGSENDFADDEHST
FEDSESRRDSLFVPHRHGERRNSNVSQASMSSRMVPGLPANGKMHSTVDCNGVVSLVGGP
SALTSPTGQLPPEGTTTETEVRKRRLSSYQISMEMLEDSSGRQRAVSIASILTNTMEELE
ESRQKCPPCWYRFANVFLIWDCCDAWLKVKHLVNLIVMDPFVDLAITICIVLNTLFMAME
HYPMTEQFSSVLTVGNLVFTGIFTAEMVLKIIAMDPYYYFQEGWNIFDGIIVSLSLMELG
LSNVEGLSVLRSFRLLRVFKLAKSWPTLNMLIKIIGNSVGALGNLTLVLAIIVFIFAVVG
MQLFGKSYKECVCKINDDCTLPRWHMNDFFHSFLIVFRVLCGEWIETMWDCMEVAGQTMC
LIVFMLVMVIGNLVVLNLFLALLLSSFSSDNLAATDDDNEMNNLQIAVGRMQKGIDYVKN
KMRECFQKAFFRKPKVIEIHEGNKIDSCMSNNTGIEISKELNYLRDGNGTTSGVGTGSSV
EKYVIDENDYMSFINNPSLTVTVPIAVGESDFENLNTEEFSSESELEESKEKLNATSSSE
GSTVDVVLPREGEQAETEPEEDLKPEACFTEGCIKKFPFCQVSTEEGKGKIWWNLRKTCY
SIVEHNWFETFIVFMILLSSGALAFEDIYIEQRKTIKTMLEYADKVFTYIFILEMLLKWV
AYGFQTYFTNAWCWLDFLIVDVSLVSLVANALGYSELGAIKSLRTLRALRPLRALSRFEG
MRVVVNALVGAIPSIMNVLLVCLIFWLIFSIMGVNLFAGKFYHCVNMTTGNMFDISDVNN
LSDCQALGKQARWKNVKVNFDNVGAGYLALLQVATFKGWMDIMYAAVDSRDVKLQPVYEE
NLYMYLYFVIFIIFGSFFTLNLFIGVIIDNFNQQKKKFGGQDIFMTEEQKKYYNAMKKLG
SKKPQKPIPRPANKFQGMVFDFVTRQVFDISIMILICLNMVTMMVETDDQGKYMTLVLSR
INLVFIVLFTGEFVLKLVSLRHYYFTIGWNIFDFVVVILSIVGMFLAEMIEKYFVSPTLF
RVIRLARIGRILRLIKGAKGIRTLLFALMMSLPALFNIGLLLFLVMFIYAIFGMSNFAYV
KKEAGIDDMFNFETFGNSMICLFQITTSAGWDGLLAPILNSAPPDCDPDTIHPGSSVKGD
CGNPSVGIFFFVSYIIISFLVVVNMYIAVILENFSVATEESAEPLSEDDFEMFYEVWEKF
DPDATQFIEFSKLSDFAAALDPPLLIAKPNKVQLIAMDLPMVSGDRIHCLDILFAFTKRV
LGESGEMDALRIQMEDRFMASNPSKVSYEPITTTLKRKQEEVSAAIIQRNFRCYLLKQRL
KNISSNYNKEAIKGRIDLPIKQDMIIDKLNGNSTPEKTDGSSSTTSPPSYDSVTKPDKEK
FEKDKPEKESKGKEVRENQK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:6agfA	0.557	0.974	0.000	1138	0.479	0.842	6agfA.pdb.gz	Structure of the human voltage-gated sodium channel Nav1.4 in complex with beta 1.
2	PDB:6j8eA	0.560	0.979	0.000	1139	0.531	0.933	6j8eA.pdb.gz	Molecular basis for pore blockade of human Na+channel Nav1.2 by the mu-conotoxin KIIIA.
3	PDB:6j8gA	0.552	0.962	0.000	1140	0.482	0.846	6j8gA.pdb.gz	Structures of human Nav1.7 channel in complex with auxiliary subunits and animal toxins.
4	PDB:7w9lA	0.642	0.897	0.000	1420	0.596	0.839	7w9lA.pdb.gz	High-resolution structures of human Na v 1.7 reveal gating modulation through alpha-pi helical transition of S6 IV.
5	PDB:7xveA	0.581	0.891	0.000	1276	0.527	0.826	7xveA.pdb.gz	Unwinding and spiral sliding of S4 and domain rotation of VSD during the electromechanical coupling in Na v 1.7.
6	AFDB:A2APX8	0.844	0.841	0.000	2009	0.844	0.840	A2APX8.pdb.gz	SCN1A_MOUSE Sodium channel protein type 1 subunit alpha OS=Mus musculus OX=10090 GN=Scn1a PE=1 SV=1
7	AFDB:B1AWN6	0.839	0.837	0.000	2006	0.874	0.871	B1AWN6.pdb.gz	SCN2A_MOUSE Sodium channel protein type 2 subunit alpha OS=Mus musculus OX=10090 GN=Scn2a PE=1 SV=1
8	AFDB:F1LQQ7	0.700	0.815	0.000	1704	0.415	0.487	F1LQQ7.pdb.gz	F1LQQ7_RAT Sodium channel protein OS=Rattus norvegicus OX=10116 GN=Scn7a PE=1 SV=4
9	AFDB:F1QXF5	0.841	0.842	0.000	1996	0.783	0.785	F1QXF5.pdb.gz	F1QXF5_DANRE Sodium channel protein OS=Danio rerio OX=7955 GN=scn1lab PE=3 SV=1
10	AFDB:P08104	0.829	0.849	0.000	1951	0.948	0.972	P08104.pdb.gz	SCN3A_RAT Sodium channel protein type 3 subunit alpha OS=Rattus norvegicus OX=10116 GN=Scn3a PE=1 SV=1
11	AFDB:Q01118	0.711	0.839	0.000	1682	0.440	0.523	Q01118.pdb.gz	SCN7A_HUMAN Sodium channel protein type 7 subunit alpha OS=Homo sapiens OX=9606 GN=SCN7A PE=1 SV=2
12	AFDB:Q15858	0.819	0.824	0.000	1988	0.762	0.767	Q15858.pdb.gz	SCN9A_HUMAN Sodium channel protein type 9 subunit alpha OS=Homo sapiens OX=9606 GN=SCN9A PE=1 SV=3
13	AFDB:Q9ER60	0.759	0.824	0.000	1841	0.643	0.699	Q9ER60.pdb.gz	SCN4A_MOUSE Sodium channel protein type 4 subunit alpha OS=Mus musculus OX=10090 GN=Scn4a PE=1 SV=1
14	AFDB:Q9UQD0	0.796	0.804	0.000	1980	0.744	0.751	Q9UQD0.pdb.gz	SCN8A_HUMAN Sodium channel protein type 8 subunit alpha OS=Homo sapiens OX=9606 GN=SCN8A PE=1 SV=1
15	PDB:6lqaB	0.556	0.958	2.542E-101	1151	0.454	0.788	6lqaB.pdb.gz	Structural Basis for Pore Blockade of the Human Cardiac Sodium Channel Na v 1.5 by the Antiarrhythmic Drug Quinidine*.
16	PDB:7we4A	0.540	0.953	7.977E-101	1122	0.401	0.714	7we4A.pdb.gz	Structural basis for high-voltage activation and subtype-specific inhibition of human Na v 1.8.
17	PDB:6uz3A	0.540	0.951	8.312E-98	1126	0.445	0.790	6uz3A.pdb.gz	Structure of the Cardiac Sodium Channel.
18	PDB:7tj9A	0.534	0.950	1.006E-81	1111	0.314	0.564	7tj9A.pdb.gz	Structure-guided unlocking of Na X reveals a non-selective tetrodotoxin-sensitive cation channel.
19	AFDB:O54898	0.518	0.464	2.076E-67	2254	0.220	0.195	O54898.pdb.gz	CAC1G_RAT Voltage-dependent T-type calcium channel subunit alpha-1G OS=Rattus norvegicus OX=10116 GN=Cacna1g PE=1 SV=2
20	PDB:7mixA	0.530	0.783	3.502E-51	1326	0.190	0.286	7mixA.pdb.gz	Structure of human Ca v 2.2 channel blocked by the painkiller ziconotide.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A0A0MT39	2452	1962	0.639	0.651	A0A0A0MT39_HUMAN Sodium channel protein OS=Homo sapiens OX=9606 GN=SCN5A PE=1 SV=1
2	A0A0R4IUM7	2545	1955	0.666	0.681	A0A0R4IUM7_DANRE Sodium channel protein OS=Danio rerio OX=7955 GN=Nav1.1 PE=3 SV=2
3	A0A1B0GVX7	2659	1618	0.667	0.824	A0A1B0GVX7_HUMAN Sodium voltage-gated channel alpha subunit 1 OS=Homo sapiens OX=9606 GN=SCN1A PE=1 SV=1
4	A0A1W2PPJ3	3329	1998	0.831	0.832	A0A1W2PPJ3_HUMAN Sodium channel protein OS=Homo sapiens OX=9606 GN=SCN1A PE=1 SV=1
5	A0A286YEQ8	1040	1915	0.254	0.265	A0A286YEQ8_HUMAN Sodium channel protein OS=Homo sapiens OX=9606 GN=SCN1A PE=1 SV=1
6	A0A286YF26	3331	1997	0.832	0.833	A0A286YF26_HUMAN Sodium channel protein OS=Homo sapiens OX=9606 GN=SCN1A PE=1 SV=1
7	A0A590UK43	2758	1939	0.724	0.747	A0A590UK43_HUMAN Sodium channel protein OS=Homo sapiens OX=9606 GN=SCN8A PE=1 SV=1
8	A0A8I6GH51	1191	1672	0.307	0.368	A0A8I6GH51_RAT Sodium channel protein OS=Rattus norvegicus OX=10116 GN=Scn7a PE=3 SV=1
9	A2APX8	3335	2009	0.835	0.831	SCN1A_MOUSE Sodium channel protein type 1 subunit alpha OS=Mus musculus OX=10090 GN=Scn1a PE=1 SV=1
10	A2ASI5	3893	1947	0.948	0.973	SCN3A_MOUSE Sodium channel protein type 3 subunit alpha OS=Mus musculus OX=10090 GN=Scn3a PE=1 SV=1
11	B1AWN6	3491	2006	0.865	0.862	SCN2A_MOUSE Sodium channel protein type 2 subunit alpha OS=Mus musculus OX=10090 GN=Scn2a PE=1 SV=1
12	B1AYL1	1245	1681	0.322	0.383	B1AYL1_MOUSE Sodium channel protein OS=Mus musculus OX=10090 GN=Scn7a PE=1 SV=1
13	E9PG18	2377	1998	0.630	0.631	E9PG18_HUMAN Sodium channel protein OS=Homo sapiens OX=9606 GN=SCN5A PE=3 SV=1
14	E9PHB6	2363	1983	0.626	0.632	E9PHB6_HUMAN Sodium channel protein OS=Homo sapiens OX=9606 GN=SCN5A PE=1 SV=1
15	F1LQQ7	1209	1680	0.310	0.370	F1LQQ7_RAT Sodium channel protein OS=Rattus norvegicus OX=10116 GN=Scn7a PE=1 SV=4
16	F1QXF5	3061	1996	0.776	0.778	F1QXF5_DANRE Sodium channel protein OS=Danio rerio OX=7955 GN=scn1lab PE=3 SV=1
17	H9KVD2	2426	2016	0.637	0.632	H9KVD2_HUMAN Sodium channel protein OS=Homo sapiens OX=9606 GN=SCN5A PE=1 SV=1
18	K4DIA1	2452	1962	0.638	0.651	K4DIA1_HUMAN Sodium channel protein OS=Homo sapiens OX=9606 GN=SCN5A PE=3 SV=1
19	O08562	2930	1984	0.765	0.771	SCN9A_RAT Sodium channel protein type 9 subunit alpha OS=Rattus norvegicus OX=10116 GN=Scn9a PE=1 SV=1
20	O88420	2860	1978	0.747	0.755	SCN8A_RAT Sodium channel protein type 8 subunit alpha OS=Rattus norvegicus OX=10116 GN=Scn8a PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00430 ATP-synt_B	2	19.9	ATP synthase B/B' CF(0)
2	PF11014 DUF2852	8.5e+02	11.5	Protein of unknown function (DUF2852)
3	PF16905 GPHH	0.96	20.7	Voltage-dependent L-type calcium channel, IQ-associated
4	PF00520 Ion_trans	2.6e-254	850.6	Ion transport protein
5	PF00612 IQ	3.7e+02	12.4	IQ calmodulin-binding motif
6	PF06512 Na_trans_assoc	3.1e-55	199.1	Sodium ion transport-associated
7	PF11933 Na_trans_cytopl	1.2e-58	209.5	Cytoplasmic domain of voltage-gated Na+ ion channel
8	PF08016 PKD_channel	2.9e-06	38.4	Polycystin cation channel

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9597.XP_008972647.1

Rank	PPI partner	STRING score	Description
1	9597.XP_003820970.1	0.934	Mediates the voltage-dependent sodium ion permeability of excitable membranes. Assuming opened or closed conformations in response to the voltage difference across the membrane, the protein forms a sodium-selective channel through which Na(+) ions may pass in accordance with their electrochemical gradient.
2	9597.XP_003820107.1	0.850	Sodium voltage-gated channel beta subunit 2
3	9597.XP_008967534.1	0.822	Sodium channel subunit beta-1
4	9597.XP_003824365.1	0.816	Sodium channel protein type 9 subunit alpha
5	9597.XP_003825589.1	0.801	Calcium homeostasis modulator 1
6	9597.XP_008956471.1	0.788	Protein unc-79 homolog isoform X1
7	9597.XP_003820009.1	0.750	Sodium voltage-gated channel beta subunit 3
8	9597.XP_003820108.1	0.733	Sodium voltage-gated channel beta subunit 4
9	9597.XP_003811402.1	0.731	Mediates the voltage-dependent sodium ion permeability of excitable membranes. Assuming opened or closed conformations in response to the voltage difference across the membrane, the protein forms a sodium-selective channel through which Na(+) ions may pass in accordance with their electrochemical gradient.
10	9597.XP_003811485.1	0.587	Voltage-dependent L-type calcium channel subunit beta-2 isoform X1
11	9597.XP_003832774.1	0.576	Voltage-dependent L-type calcium channel subunit beta-4 isoform X1
12	9597.XP_003823073.2	0.567	Neuron navigator 1
13	9597.XP_003809882.1	0.566	Calcium voltage-gated channel auxiliary subunit beta 1
14	9597.XP_003822789.1	0.564	Voltage-dependent calcium channel subunit alpha-2/delta-1 isoform X1
15	9597.XP_008957252.1	0.545	Unc-80 homolog, NALCN activator
16	9597.XP_008960521.1	0.544	Belongs to the potassium channel family.
17	9597.XP_003806519.1	0.541	Belongs to the protein kinase superfamily. Tyr protein kinase family. CSF-1/PDGF receptor subfamily.
18	9597.XP_003825857.1	0.530	Calcium voltage-gated channel auxiliary subunit beta 3
19	9597.XP_003821230.1	0.520	Ankyrin 3
20	9597.XP_008955683.1	0.518	Fibroblast growth factor 14 isoform X1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005248	1.000	voltage-gated sodium channel activity
GO:0005515	0.992	protein binding
GO:0022836	0.597	gated channel activity
GO:0022839	0.594	monoatomic ion gated channel activity
GO:0022832	0.567	voltage-gated channel activity
GO:0005244	0.563	voltage-gated monoatomic ion channel activity
GO:0043167	0.367	ion binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.988	cellular process
GO:0065007	0.979	biological regulation
GO:0032501	0.975	multicellular organismal process
GO:0050896	0.935	response to stimulus
GO:0065008	0.914	regulation of biological quality
GO:0006814	0.904	sodium ion transport
GO:0042391	0.901	regulation of membrane potential
GO:0001508	0.861	action potential
GO:0003008	0.854	system process
GO:0007154	0.725	cell communication
GO:0050789	0.677	regulation of biological process
GO:0055085	0.573	transmembrane transport
GO:0050877	0.569	nervous system process
GO:0034220	0.495	monoatomic ion transmembrane transport
GO:0098662	0.490	inorganic cation transmembrane transport
GO:0098655	0.490	monoatomic cation transmembrane transport
GO:0019228	0.487	neuronal action potential
GO:0032502	0.387	developmental process
GO:0048856	0.362	anatomical structure development
GO:0007610	0.344	behavior
GO:0023052	0.332	signaling
GO:0050794	0.322	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032991	0.999	protein-containing complex
GO:0005886	0.999	plasma membrane
GO:0034703	0.992	cation channel complex
GO:0034706	0.964	sodium channel complex
GO:0098797	0.854	plasma membrane protein complex
GO:0005622	0.803	intracellular anatomical structure
GO:0043229	0.695	intracellular organelle
GO:0043231	0.683	intracellular membrane-bounded organelle
GO:0001518	0.657	voltage-gated sodium channel complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:34963	1.000	Na(+)(in) = Na(+)(out)

[back to server]