StarFunc result for job id Q9NY47

User Input

>input (1150 residues)
MAVPARTCGASRPGPARTARPWPGCGPHPGPGTRRPTSGPPRPLWLLLPLLPLLAAPGAS
AYSFPQQHTMQHWARRLEQEVDGVMRIFGGVQQLREIYKDNRNLFEVQENEPQKLVEKVA
GDIESLLDRKVQALKRLADAAENFQKAHRWQDNIKEEDIVYYDAKADAELDDPESEDVER
GSKASTLRLDFIEDPNFKNKVNYSYAAVQIPTDIYKGSTVILNELNWTEALENVFMENRR
QDPTLLWQVFGSATGVTRYYPATPWRAPKKIDLYDVRRRPWYIQGASSPKDMVIIVDVSG
SVSGLTLKLMKTSVCEMLDTLSDDDYVNVASFNEKAQPVSCFTHLVQANVRNKKVFKEAV
QGMVAKGTTGYKAGFEYAFDQLQNSNITRANCNKMIMMFTDGGEDRVQDVFEKYNWPNRT
VRVFTFSVGQHNYDVTPLQWMACANKGYYFEIPSIGAIRINTQEYLDVLGRPMVLAGKEA
KQVQWTNVYEDALGLGLVVTGTLPVFNLTQDGPGEKKNQLILGVMGIDVALNDIKRLTPN
YTLGANGYVFAIDLNGYVLLHPNLKPQTTNFREPVTLDFLDAELEDENKEEIRRSMIDGN
KGHKQIRTLVKSLDERYIDEVTRNYTWVPIRSTNYSLGLVLPPYSTFYLQANLSDQILQV
KLPISKLKDFEFLLPSSFESEGHVFIAPREYCKDLNASDNNTEFLKNFIELMEKVTPDSK
QCNNFLLHNLILDTGITQQLVERVWRDQDLNTYSLLAVFAATDGGITRVFPNKAAEDWTE
NPEPFNASFYRRSLDNHGYVFKPPHQDALLRPLELENDTVGILVSTAVELSLGRRTLRPA
VVGVKLDLEAWAEKFKVLASNRTHQDQPQKCGPNSHCEMDCEVNNEDLLCVLIDDGGFLV
LSNQNHQWDQVGRFFSEVDANLMLALYNNSFYTRKESYDYQAACAPQPPGNLGAAPRGVF
VPTVADFLNLAWWTSAAAWSLFQQLLYGLIYHSWFQADPAEAEGSPETRESSCVMKQTQY
YFGSVNASYNAIIDCGNCSRLFHAQRLTNTNLLFVVAEKPLCSQCEAGRLLQKETHSDGP
EQCELVQRPRYRRGPHICFDYNATEDTSDCGRGASFPPSLGVLVSLQLLLLLGLPPRPQP
QVLVHASRRL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:6jp8F	0.778	0.915	0.000	973	0.477	0.564	6jp8F.pdb.gz	Molecular Basis for Ligand Modulation of a Mammalian Voltage-Gated Ca2+Channel.
2	AFDB:A0A2R8QDT8	0.842	0.860	0.000	1125	0.490	0.501	A0A2R8QDT8.pdb.gz
3	AFDB:E7F4T2	0.819	0.862	0.000	1091	0.489	0.515	E7F4T2.pdb.gz	E7F4T2_DANRE Calcium channel, voltage-dependent, alpha 2/delta subunit 1a OS=Danio rerio OX=7955 GN=si:ch211-251k4.1 PE=1 SV=2
4	AFDB:P13806	0.820	0.851	0.000	1106	0.505	0.525	P13806.pdb.gz	CA2D1_RABIT Voltage-dependent calcium channel subunit alpha-2/delta-1 OS=Oryctolagus cuniculus OX=9986 GN=CACNA2D1 PE=1 SV=1
5	AFDB:P54290	0.816	0.859	0.000	1091	0.499	0.526	P54290.pdb.gz	CA2D1_RAT Voltage-dependent calcium channel subunit alpha-2/delta-1 OS=Rattus norvegicus OX=10116 GN=Cacna2d1 PE=1 SV=1
6	AFDB:Q8CFG6	0.910	0.904	0.000	1157	0.963	0.957	Q8CFG6.pdb.gz	CA2D2_RAT Voltage-dependent calcium channel subunit alpha-2/delta-2 OS=Rattus norvegicus OX=10116 GN=Cacna2d2 PE=2 SV=1
7	AFDB:Q7Z3S7	0.696	0.704	2.530E-85	1137	0.286	0.289	Q7Z3S7.pdb.gz	CA2D4_HUMAN Voltage-dependent calcium channel subunit alpha-2/delta-4 OS=Homo sapiens OX=9606 GN=CACNA2D4 PE=1 SV=2
8	AFDB:Q8CFG5	0.695	0.731	4.936E-84	1085	0.270	0.287	Q8CFG5.pdb.gz	CA2D3_RAT Voltage-dependent calcium channel subunit alpha-2/delta-3 OS=Rattus norvegicus OX=10116 GN=Cacna2d3 PE=1 SV=1
9	AFDB:F1QYJ5	0.682	0.717	3.161E-83	1087	0.269	0.284	F1QYJ5.pdb.gz
10	AFDB:A0A0B4K7P4	0.694	0.650	3.440E-77	1237	0.274	0.255	A0A0B4K7P4.pdb.gz	A0A0B4K7P4_DROME Straightjacket, isoform D OS=Drosophila melanogaster OX=7227 GN=stj PE=1 SV=1
11	AFDB:A0A0B4K866	0.667	0.609	6.783E-74	1271	0.263	0.238	A0A0B4K866.pdb.gz	A0A0B4K866_DROME Straightjacket, isoform C OS=Drosophila melanogaster OX=7227 GN=stj PE=1 SV=1
12	PDB:4nehA	0.133	0.141	5.635E-7	1084	0.039	0.042	4nehA.pdb.gz	An internal ligand-bound, metastable state of a leukocyte integrin, alpha X beta 2.
13	PDB:4nenA	0.133	0.143	9.084E-7	1063	0.037	0.040	4nenA.pdb.gz	An internal ligand-bound, metastable state of a leukocyte integrin, alpha X beta 2.
14	PDB:6gym6	0.137	0.413	2.768E-6	335	0.026	0.090	6gym6.pdb.gz	Promoter Distortion and Opening in the RNA Polymerase II Cleft.
15	PDB:5kynA	0.121	0.182	5.232E-6	730	0.050	0.079	5kynA.pdb.gz	TANGO1/cTAGE5 receptor as a polyvalent template for assembly of large COPII coats.
16	PDB:1m2vA	0.132	0.202	5.817E-6	705	0.050	0.081	1m2vA.pdb.gz	Structure of the Sec23/24-Sar1 pre-budding complex of the COPII vesicle coat
17	PDB:6zheC	0.115	0.176	1.434E-5	705	0.050	0.082	6zheC.pdb.gz	Dimers of DNA-PK create a stage for DNA double-strand break repair.
18	PDB:5y58A	0.133	0.257	1.512E-5	548	0.050	0.104	5y58A.pdb.gz	Structural Insights into Yeast Telomerase Recruitment to Telomeres
19	PDB:6zgaA	0.133	0.195	1.681E-5	751	0.032	0.049	6zgaA.pdb.gz	Structure of the complete, membrane-assembled COPII coat reveals a complex interaction network.
20	PDB:5l4kW	0.133	0.697	2.437E-5	196	0.022	0.128	5l4kW.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	E7F4T2	0.0	1090	1091	0.485	0.511	E7F4T2_DANRE Calcium channel, voltage-dependent, alpha 2/delta subunit 1a OS=Danio rerio OX=7955 GN=si:ch211-251k4.1 PE=1 SV=2
2	O08532	0.0	1166	1103	0.517	0.539	CA2D1_MOUSE Voltage-dependent calcium channel subunit alpha-2/delta-1 OS=Mus musculus OX=10090 GN=Cacna2d1 PE=1 SV=1
3	P13806	0.0	1177	1106	0.517	0.538	CA2D1_RABIT Voltage-dependent calcium channel subunit alpha-2/delta-1 OS=Oryctolagus cuniculus OX=9986 GN=CACNA2D1 PE=1 SV=1
4	P54289	0.0	1182	1103	0.519	0.541	CA2D1_HUMAN Voltage-dependent calcium channel subunit alpha-2/delta-1 OS=Homo sapiens OX=9606 GN=CACNA2D1 PE=1 SV=3
5	P54290	0.0	1162	1091	0.513	0.541	CA2D1_RAT Voltage-dependent calcium channel subunit alpha-2/delta-1 OS=Rattus norvegicus OX=10116 GN=Cacna2d1 PE=1 SV=1
6	Q5TZ68	0.0	1081	1069	0.481	0.517	Q5TZ68_DANRE Calcium channel, voltage-dependent, alpha 2/delta subunit 1a OS=Danio rerio OX=7955 GN=si:ch211-251k4.1 PE=1 SV=2
7	Q6PHS9	0.0	2322	1154	0.970	0.966	CA2D2_MOUSE Voltage-dependent calcium channel subunit alpha-2/delta-2 OS=Mus musculus OX=10090 GN=Cacna2d2 PE=1 SV=1
8	Q8CFG6	0.0	2222	1157	0.939	0.933	CA2D2_RAT Voltage-dependent calcium channel subunit alpha-2/delta-2 OS=Rattus norvegicus OX=10116 GN=Cacna2d2 PE=2 SV=1
9	Q9NY47	0.0	2396	1150	1.000	1.000	CA2D2_HUMAN Voltage-dependent calcium channel subunit alpha-2/delta-2 OS=Homo sapiens OX=9606 GN=CACNA2D2 PE=1 SV=2
10	Q8CFG5	1.10e-133	436	1085	0.279	0.296	CA2D3_RAT Voltage-dependent calcium channel subunit alpha-2/delta-3 OS=Rattus norvegicus OX=10116 GN=Cacna2d3 PE=1 SV=1
11	Q7Z3S7	5.64e-131	430	1137	0.283	0.287	CA2D4_HUMAN Voltage-dependent calcium channel subunit alpha-2/delta-4 OS=Homo sapiens OX=9606 GN=CACNA2D4 PE=1 SV=2
12	Q7K0H4	1.98e-99	345	1218	0.250	0.236	Q7K0H4_DROME SD07723p OS=Drosophila melanogaster OX=7227 GN=stj PE=1 SV=1
13	A0A0B4K866	7.61e-96	335	1271	0.256	0.231	A0A0B4K866_DROME Straightjacket, isoform C OS=Drosophila melanogaster OX=7227 GN=stj PE=1 SV=1
14	Q8IP22	3.56e-84	301	1215	0.229	0.216	Q8IP22_DROME Ca[2+] channel Muscle-specific alpha2/delta subunit, isoform A OS=Drosophila melanogaster OX=7227 GN=Ca-Ma2d PE=2 SV=2
15	X2J9Z3	2.76e-74	272	1271	0.165	0.149	X2J9Z3_DROME Stolid, isoform H OS=Drosophila melanogaster OX=7227 GN=stol PE=1 SV=1
16	A0A0B4K7P4	3.44e-71	262	1237	0.135	0.125	A0A0B4K7P4_DROME Straightjacket, isoform D OS=Drosophila melanogaster OX=7227 GN=stj PE=1 SV=1
17	G4S4A1	1.24e-48	191	1205	0.189	0.180	G4S4A1_CAEEL VWFA domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=unc-36 PE=1 SV=1
18	P34374	3.29e-44	177	1249	0.188	0.173	UNC36_CAEEL Voltage-dependent calcium channel unc-36 OS=Caenorhabditis elegans OX=6239 GN=unc-36 PE=1 SV=2
19	Q95R75	1.99e-38	157	842	0.145	0.198	Q95R75_DROME SD03196p OS=Drosophila melanogaster OX=7227 GN=stj PE=2 SV=1
20	Q61704	7.73e-07	55.8	889	0.042	0.054	ITIH3_MOUSE Inter-alpha-trypsin inhibitor heavy chain H3 OS=Mus musculus OX=10090 GN=Itih3 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02743 dCache_1	0.0031	28.6	Cache domain
2	PF08269 dCache_2	1.4e+02	13.1	Cache domain
3	PF18433 DUF5610	5.8e+02	12.4	Domain of unknown function (DUF5610)
4	PF10183 ESSS	1.8e+02	13.8	ESSS subunit of NADH:ubiquinone oxidoreductase (complex I)
5	PF15542 Ntox50	6.7e+02	12.5	Bacterial toxin 50
6	PF20232 T6SS_FHA_C	86	14.3	C-terminal domain of Type VI secretion system FHA protein
7	PF08473 VGCC_alpha2	3e-211	713.5	Neuronal voltage-dependent calcium channel alpha 2acd
8	PF00092 VWA	8.1e-12	57.2	von Willebrand factor type A domain
9	PF13519 VWA_2	5.7e-08	44.7	von Willebrand factor type A domain
10	PF13768 VWA_3	4.2e-10	51.2	von Willebrand factor type A domain
11	PF05762 VWA_CoxE	2.4e+02	12.5	VWA domain containing CoxE-like protein
12	PF08399 VWA_N	1.1e-34	131.1	VWA N-terminal

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000418081

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000377840	0.968	Voltage-dependent L-type calcium channel subunit beta-1
2	9606.ENSP00000438949	0.961	Voltage-dependent L-type calcium channel subunit beta-4
3	9606.ENSP00000320025	0.958	Voltage-dependent L-type calcium channel subunit beta-2
4	9606.ENSP00000353362	0.956	Voltage-dependent P/Q-type calcium channel subunit alpha-1A
5	9606.ENSP00000226021	0.952	Voltage-dependent calcium channel gamma-1 subunit
6	9606.ENSP00000266376	0.946	Voltage-dependent L-type calcium channel subunit alpha-1C
7	9606.ENSP00000288139	0.944	Voltage-dependent L-type calcium channel subunit alpha-1D
8	9606.ENSP00000362399	0.930	Syntaxin-binding protein 1
9	9606.ENSP00000346265	0.928	Synaptotagmin-5
10	9606.ENSP00000356545	0.928	Voltage-dependent R-type calcium channel subunit alpha-1E
11	9606.ENSP00000300873	0.919	Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-8
12	9606.ENSP00000314214	0.917	Vesicle-associated membrane protein 2
13	9606.ENSP00000375727	0.917	Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-4
14	9606.ENSP00000371594	0.912	Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-7
15	9606.ENSP00000254976	0.910	Synaptosomal-associated protein 25
16	9606.ENSP00000426022	0.909	Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-T2
17	9606.ENSP00000229264	0.907	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3
18	9606.ENSP00000294117	0.905	Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-3
19	9606.ENSP00000222812	0.904	Syntaxin-1A
20	9606.ENSP00000248150	0.904	Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-13

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005245	1.000	voltage-gated calcium channel activity
GO:0005515	0.994	protein binding
GO:0098772	0.961	molecular function regulator activity
GO:0005246	0.950	calcium channel regulator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.994	regulation of biological process
GO:0009987	0.988	cellular process
GO:0006816	0.949	calcium ion transport
GO:0050794	0.932	regulation of cellular process
GO:0051239	0.930	regulation of multicellular organismal process
GO:0032501	0.709	multicellular organismal process
GO:0050896	0.609	response to stimulus
GO:0007154	0.422	cell communication
GO:0023052	0.338	signaling
GO:0032879	0.304	regulation of localization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:1902495	0.995	transmembrane transporter complex
GO:0034703	0.993	cation channel complex
GO:0098797	0.991	plasma membrane protein complex
GO:0034704	0.974	calcium channel complex
GO:0005891	0.958	voltage-gated calcium channel complex
GO:0043227	0.583	membrane-bounded organelle
GO:0005622	0.555	intracellular anatomical structure
GO:0005737	0.539	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:29671	1.000	Ca(2+)(in) = Ca(2+)(out)

[back to server]