StarFunc result for job id Q9NY64

User Input

>input (477 residues)
MTPEDPEETQPLLGPPGGSAPRGRRVFLAAFAAALGPLSFGFALGYSSPAIPSLQRAAPP
APRLDDAAASWFGAVVTLGAAAGGVLGGWLVDRAGRKLSLLLCSVPFVAGFAVITAAQDV
WMLLGGRLLTGLACGVASLVAPVYISEIAYPAVRGLLGSCVQLMVVVGILLAYLAGWVLE
WRWLAVLGCVPPSLMLLLMCFMPETPRFLLTQHRRQEAMAALRFLWGSEQGWEDPPIGAE
QSFHLALLRQPGIYKPFIIGVSLMAFQQLSGVNAVMFYAETIFEEAKFKDSSLASVVVGV
IQVLFTAVAALIMDRAGRRLLLVLSGVVMVFSTSAFGAYFKLTQGGPGNSSHVAISAPVS
AQPVDASVGLAWLAVGSMCLFIAGFAVGWGPIPWLLMSEIFPLHVKGVATGICVLTNWLM
AFLVTKEFSSLMEVLRPYGAFWLASAFCIFSVLFTLFCVPETKGKTLEQITAHFEGR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9NY64	1.000	1.000	3.803E-62	477	1.000	1.000	Q9NY64.pdb.gz	SL2A8_HUMAN Solute carrier family 2, facilitated glucose transporter member 8 OS=Homo sapiens OX=9606 GN=SLC2A8 PE=1 SV=3
2	AFDB:Q9JJZ1	0.952	0.950	1.441E-55	478	0.855	0.854	Q9JJZ1.pdb.gz	SL2A8_RAT Solute carrier family 2, facilitated glucose transporter member 8 OS=Rattus norvegicus OX=10116 GN=Slc2a8 PE=1 SV=1
3	AFDB:Q3UDF0	0.859	0.825	2.292E-32	497	0.426	0.408	Q3UDF0.pdb.gz	GTR6_MOUSE Solute carrier family 2, facilitated glucose transporter member 6 OS=Mus musculus OX=10090 GN=Slc2a6 PE=1 SV=1
4	AFDB:F1RB41	0.833	0.812	1.862E-30	490	0.382	0.371	F1RB41.pdb.gz	F1RB41_DANRE Solute carrier family 2 member 6 OS=Danio rerio OX=7955 GN=slc2a6 PE=3 SV=1
5	AFDB:Q9UGQ3	0.847	0.800	9.887E-30	507	0.436	0.410	Q9UGQ3.pdb.gz	GTR6_HUMAN Solute carrier family 2, facilitated glucose transporter member 6 OS=Homo sapiens OX=9606 GN=SLC2A6 PE=1 SV=2
6	AFDB:A9ZSY2	0.763	0.728	3.480E-27	502	0.344	0.327	A9ZSY2.pdb.gz	TRET1_APILI Facilitated trehalose transporter Tret1 OS=Apis mellifera ligustica OX=7469 GN=Tret1 PE=1 SV=1
7	AFDB:A1Z8N1	0.746	0.441	4.628E-27	857	0.356	0.198	A1Z8N1.pdb.gz	TRE11_DROME Facilitated trehalose transporter Tret1-1 OS=Drosophila melanogaster OX=7227 GN=Tret1-1 PE=1 SV=1
8	AFDB:A9ZSY3	0.754	0.717	9.631E-27	505	0.352	0.333	A9ZSY3.pdb.gz	TRET1_BOMMO Facilitated trehalose transporter Tret1 OS=Bombyx mori OX=7091 GN=Tret1 PE=1 SV=1
9	AFDB:Q7PIR5	0.761	0.483	1.045E-26	793	0.365	0.219	Q7PIR5.pdb.gz	TRET1_ANOGA Facilitated trehalose transporter Tret1 OS=Anopheles gambiae OX=7165 GN=Tret1 PE=1 SV=3
10	AFDB:A5LGM7	0.747	0.711	1.334E-26	504	0.342	0.323	A5LGM7.pdb.gz	TRET1_POLVA Facilitated trehalose transporter Tret1 OS=Polypedilum vanderplanki OX=319348 GN=Tret1 PE=1 SV=1
11	PDB:7sptA	0.842	0.854	7.422E-24	470	0.304	0.309	7sptA.pdb.gz	Molecular basis for inhibiting human glucose transporters by exofacial inhibitors.
12	PDB:4gbyA	0.769	0.772	1.632E-20	475	0.296	0.297	4gbyA.pdb.gz	Crystal structure of a bacterial homologue of glucose transporters GLUT1-4.
13	PDB:4ybqB	0.816	0.841	1.107E-19	462	0.281	0.290	4ybqB.pdb.gz
14	PDB:7aaqA	0.778	0.762	2.038E-19	487	0.268	0.263	7aaqA.pdb.gz	Molecular mechanism of sugar transport in plants unveiled by structures of glucose/H + symporter STP10.
15	PDB:7wsmA	0.704	0.722	3.322E-19	464	0.300	0.308	7wsmA.pdb.gz	Cryo-EM structure of human glucose transporter GLUT4.
16	PDB:6thaA	0.693	0.732	2.443E-18	448	0.260	0.277	6thaA.pdb.gz
17	PDB:4ja4A	0.608	0.649	1.213E-14	442	0.277	0.299	4ja4A.pdb.gz
18	PDB:7zh0A	0.622	0.602	2.405E-10	495	0.178	0.172	7zh0A.pdb.gz
19	PDB:6s4mA	0.561	0.621	6.510E-9	426	0.164	0.183	6s4mA.pdb.gz
20	PDB:7oixB	0.560	0.587	1.406E-6	451	0.117	0.124	7oixB.pdb.gz	Structural insights into the lysophospholipid brain uptake mechanism and its inhibition by syncytin-2.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9JIF3	0.0	785	477	0.864	0.864	SL2A8_MOUSE Solute carrier family 2, facilitated glucose transporter member 8 OS=Mus musculus OX=10090 GN=Slc2a8 PE=1 SV=2
2	Q9JJZ1	0.0	783	478	0.855	0.854	SL2A8_RAT Solute carrier family 2, facilitated glucose transporter member 8 OS=Rattus norvegicus OX=10116 GN=Slc2a8 PE=1 SV=1
3	Q9NY64	0.0	942	477	1.000	1.000	SL2A8_HUMAN Solute carrier family 2, facilitated glucose transporter member 8 OS=Homo sapiens OX=9606 GN=SLC2A8 PE=1 SV=3
4	Q3UDF0	2.05e-112	342	497	0.436	0.419	GTR6_MOUSE Solute carrier family 2, facilitated glucose transporter member 6 OS=Mus musculus OX=10090 GN=Slc2a6 PE=1 SV=1
5	Q9UGQ3	1.81e-109	335	507	0.447	0.420	GTR6_HUMAN Solute carrier family 2, facilitated glucose transporter member 6 OS=Homo sapiens OX=9606 GN=SLC2A6 PE=1 SV=2
6	F1RB41	5.69e-104	320	490	0.398	0.388	F1RB41_DANRE Solute carrier family 2 member 6 OS=Danio rerio OX=7955 GN=slc2a6 PE=3 SV=1
7	Q8MKK4	3.01e-95	298	488	0.363	0.355	TRE12_DROME Facilitated trehalose transporter Tret1-2 homolog OS=Drosophila melanogaster OX=7227 GN=Tret1-2 PE=2 SV=1
8	A9ZSY3	5.17e-93	293	505	0.354	0.335	TRET1_BOMMO Facilitated trehalose transporter Tret1 OS=Bombyx mori OX=7091 GN=Tret1 PE=1 SV=1
9	Q8IQH6	9.89e-90	283	471	0.344	0.348	Q8IQH6_DROME Nebulosa, isoform A OS=Drosophila melanogaster OX=7227 GN=nebu PE=1 SV=1
10	Q9VU17	2.38e-89	284	539	0.344	0.304	Q9VU17_DROME HL01062p OS=Drosophila melanogaster OX=7227 GN=nebu PE=1 SV=1
11	A5LGM7	8.28e-88	279	504	0.344	0.325	TRET1_POLVA Facilitated trehalose transporter Tret1 OS=Polypedilum vanderplanki OX=319348 GN=Tret1 PE=1 SV=1
12	Q7PIR5	1.89e-86	283	793	0.356	0.214	TRET1_ANOGA Facilitated trehalose transporter Tret1 OS=Anopheles gambiae OX=7165 GN=Tret1 PE=1 SV=3
13	A9ZSY2	6.93e-85	271	502	0.338	0.321	TRET1_APILI Facilitated trehalose transporter Tret1 OS=Apis mellifera ligustica OX=7469 GN=Tret1 PE=1 SV=1
14	Q9FRL3	1.51e-82	265	487	0.363	0.355	ERDL6_ARATH Sugar transporter ERD6-like 6 OS=Arabidopsis thaliana OX=3702 GN=At1g75220 PE=1 SV=1
15	Q93YP9	8.91e-82	263	488	0.356	0.348	ERDL4_ARATH Sugar transporter ERD6-like 4 OS=Arabidopsis thaliana OX=3702 GN=At1g19450 PE=2 SV=1
16	A1Z8N1	2.46e-77	260	857	0.356	0.198	TRE11_DROME Facilitated trehalose transporter Tret1-1 OS=Drosophila melanogaster OX=7227 GN=Tret1-1 PE=1 SV=1
17	P93051	3.73e-72	237	463	0.365	0.376	ERDL7_ARATH Sugar transporter ERD6-like 7 OS=Arabidopsis thaliana OX=3702 GN=At2g48020 PE=2 SV=2
18	Q0WQ63	5.06e-71	234	470	0.350	0.355	ERDL8_ARATH Sugar transporter ERD6-like 8 OS=Arabidopsis thaliana OX=3702 GN=At3g05150 PE=2 SV=1
19	P0AE24	1.86e-65	220	472	0.331	0.335	ARAE_ECOLI Arabinose-proton symporter OS=Escherichia coli (strain K12) OX=83333 GN=araE PE=1 SV=1
20	O04036	3.89e-60	206	496	0.325	0.312	ERD6_ARATH Sugar transporter ERD6 OS=Arabidopsis thaliana OX=3702 GN=ERD6 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07690 MFS_1	3.7e-18	77.2	Major Facilitator Superfamily
2	PF00083 Sugar_tr	2e-97	338.6	Sugar (and other) transporter

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000362469

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000482835	0.951	AP-2 complex subunit beta
2	9606.ENSP00000327694	0.704	AP-2 complex subunit alpha-2
3	9606.ENSP00000376732	0.672	Mitochondrial ribosomal protein S33
4	9606.ENSP00000419088	0.672	Protein FAM162A
5	9606.ENSP00000302629	0.666	Chondroitin sulfate synthase 3
6	9606.ENSP00000482657	0.660	Mitogen-activated protein kinase kinase kinase 14
7	9606.ENSP00000302851	0.625	Solute carrier family 23 member 1
8	9606.ENSP00000348395	0.622	Probable aminopeptidase NPEPL1
9	9606.ENSP00000351926	0.617	AP-2 complex subunit alpha-1
10	9606.ENSP00000266088	0.612	Sodium/glucose cotransporter 1
11	9606.ENSP00000264029	0.603	Trehalase
12	9606.ENSP00000263270	0.600	AP-2 complex subunit sigma
13	9606.ENSP00000292807	0.600	AP-2 complex subunit mu
14	9606.ENSP00000426455	0.588	Ribonuclease T2
15	9606.ENSP00000353224	0.586	Transferrin receptor protein 1
16	9606.ENSP00000394863	0.581	Palmitoyl-protein thioesterase 1
17	9606.ENSP00000281924	0.578	Transmembrane protein 163
18	9606.ENSP00000397157	0.571	P53 apoptosis effector related to PMP-22
19	9606.ENSP00000380432	0.567	Insulin
20	9606.ENSP00000426906	0.566	Belongs to the RNase T2 family.

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005355	0.999	glucose transmembrane transporter activity
GO:0008514	0.888	organic anion transmembrane transporter activity
GO:0005488	0.847	binding
GO:0005515	0.800	protein binding
GO:0055056	0.749	D-glucose transmembrane transporter activity
GO:0090482	0.711	vitamin transmembrane transporter activity
GO:0022804	0.686	active transmembrane transporter activity
GO:0015291	0.551	secondary active transmembrane transporter activity
GO:0015318	0.503	inorganic molecular entity transmembrane transporter activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0051179	0.994	localization
GO:0009987	0.991	cellular process
GO:0051234	0.984	establishment of localization
GO:0006810	0.974	transport
GO:0008152	0.945	metabolic process
GO:0055085	0.939	transmembrane transport
GO:0008643	0.931	carbohydrate transport
GO:0071704	0.872	organic substance metabolic process
GO:0044238	0.854	primary metabolic process
GO:0015749	0.566	monosaccharide transmembrane transport
GO:0008645	0.533	hexose transmembrane transport
GO:0005975	0.473	carbohydrate metabolic process
GO:0050789	0.326	regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.997	plasma membrane
GO:0043226	0.996	organelle
GO:0043227	0.989	membrane-bounded organelle
GO:0005737	0.977	cytoplasm
GO:0043231	0.977	intracellular membrane-bounded organelle
GO:0031982	0.953	vesicle
GO:0012505	0.948	endomembrane system
GO:0030659	0.943	cytoplasmic vesicle membrane
GO:0098588	0.884	bounding membrane of organelle
GO:0030135	0.798	coated vesicle
GO:0030139	0.776	endocytic vesicle
GO:0030136	0.775	clathrin-coated vesicle
GO:0045334	0.714	clathrin-coated endocytic vesicle
GO:0030666	0.696	endocytic vesicle membrane
GO:0030665	0.692	clathrin-coated vesicle membrane
GO:0030669	0.549	clathrin-coated endocytic vesicle membrane
GO:0099503	0.450	secretory vesicle
GO:0005764	0.432	lysosome
GO:0098852	0.414	lytic vacuole membrane
GO:0005765	0.386	lysosomal membrane
GO:0005576	0.328	extracellular region
GO:1903561	0.314	extracellular vesicle
GO:0030054	0.302	cell junction
GO:0070062	0.301	extracellular exosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]