StarFunc result for job id Q9NY72

User Input

>input (215 residues)
MPAFNRLFPLASLVLIYWVSVCFPVCVEVPSETEAVQGNPMKLRCISCMKREEVEATTVV
EWFYRPEGGKDFLIYEYRNGHQEVESPFQGRLQWNGSKDLQDVSITVLNVTLNDSGLYTC
NVSREFEFEAHRPFVKTTRLIPLRVTEEAGEDFTSVVSEIMMYILLVFLTLWLLIEMIYC
YRKVSKAEEAAQENASDYLAIPSENKENSAVPVEE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8BHK2	0.836	0.836	4.802E-36	215	0.977	0.977	Q8BHK2.pdb.gz	SCN3B_MOUSE Sodium channel subunit beta-3 OS=Mus musculus OX=10090 GN=Scn3b PE=1 SV=1
2	AFDB:Q06W32	0.781	0.762	6.023E-21	221	0.428	0.416	Q06W32.pdb.gz	Q06W32_DANRE Sodium channel subunit beta-1 precursor OS=Danio rerio OX=7955 GN=SCN1B PE=2 SV=1
3	AFDB:P97952	0.759	0.749	1.035E-20	218	0.484	0.477	P97952.pdb.gz	SCN1B_MOUSE Sodium channel subunit beta-1 OS=Mus musculus OX=10090 GN=Scn1b PE=1 SV=1
4	AFDB:B3F0A3	0.781	0.758	3.407E-20	222	0.433	0.419	B3F0A3.pdb.gz	B3F0A3_DANRE Sodium channel beta 1 subunit OS=Danio rerio OX=7955 GN=scn1bb PE=2 SV=1
5	AFDB:O60487	0.515	0.515	4.672E-12	215	0.186	0.186	O60487.pdb.gz	MPZL2_HUMAN Myelin protein zero-like protein 2 OS=Homo sapiens OX=9606 GN=MPZL2 PE=1 SV=1
6	AFDB:P06907	0.524	0.462	4.932E-12	248	0.256	0.222	P06907.pdb.gz	MYP0_RAT Myelin protein P0 OS=Rattus norvegicus OX=10116 GN=Mpz PE=1 SV=1
7	AFDB:O60939	0.562	0.562	1.538E-11	215	0.191	0.191	O60939.pdb.gz	SCN2B_HUMAN Sodium channel subunit beta-2 OS=Homo sapiens OX=9606 GN=SCN2B PE=1 SV=1
8	AFDB:O70255	0.496	0.496	2.643E-11	215	0.191	0.191	O70255.pdb.gz	MPZL2_MOUSE Myelin protein zero-like protein 2 OS=Mus musculus OX=10090 GN=Mpzl2 PE=1 SV=1
9	AFDB:A0A2R8QN30	0.521	0.492	2.945E-11	228	0.228	0.215	A0A2R8QN30.pdb.gz	A0A2R8QN30_DANRE Myelin protein P0 isoform X1 OS=Danio rerio OX=7955 GN=p0 PE=1 SV=1
10	AFDB:A2BGB5	0.456	0.489	4.302E-11	199	0.195	0.211	A2BGB5.pdb.gz
11	PDB:3oaiA	0.462	0.212	3.131E-10	488	0.158	0.070	3oaiA.pdb.gz	Crystal structure of the extracellular domain of human myelin protein zero.
12	PDB:1ezvX	0.417	0.667	1.914E-6	127	0.079	0.134	1ezvX.pdb.gz	Structure at 2.3 A resolution of the cytochrome bc(1) complex from the yeast Saccharomyces cerevisiae co-crystallized with an antibody Fv fragment.
13	PDB:6hd8A	0.428	0.213	2.021E-6	461	0.088	0.041	6hd8A.pdb.gz	Structural basis for ion selectivity in TMEM175 K+channels.
14	PDB:2qhrL	0.405	0.400	2.377E-6	218	0.102	0.101	2qhrL.pdb.gz	Complex of a protective antibody with its Ebola virus GP peptide epitope: unusual features of a V lambda x light chain.
15	PDB:5ir3A	0.400	0.719	3.666E-6	111	0.074	0.144	5ir3A.pdb.gz
16	PDB:1cd0A	0.377	0.689	3.870E-6	111	0.084	0.162	1cd0A.pdb.gz
17	PDB:5c6wJ	0.428	0.392	5.355E-6	238	0.074	0.067	5c6wJ.pdb.gz
18	PDB:6dldD	0.367	0.298	5.968E-6	269	0.116	0.093	6dldD.pdb.gz
19	PDB:2cd0A	0.376	0.690	8.719E-6	111	0.084	0.162	2cd0A.pdb.gz
20	PDB:6rulA	0.356	0.284	8.719E-6	276	0.079	0.062	6rulA.pdb.gz	Chemogenetic Control of Nanobodies.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9NY72	1.64e-160	443	215	1.000	1.000	SCN3B_HUMAN Sodium channel subunit beta-3 OS=Homo sapiens OX=9606 GN=SCN3B PE=1 SV=1
2	Q9JK00	1.74e-157	436	215	0.981	0.981	SCN3B_RAT Sodium channel subunit beta-3 OS=Rattus norvegicus OX=10116 GN=Scn3b PE=1 SV=1
3	Q8BHK2	2.01e-156	433	215	0.977	0.977	SCN3B_MOUSE Sodium channel subunit beta-3 OS=Mus musculus OX=10090 GN=Scn3b PE=1 SV=1
4	B3F0A3	3.34e-55	177	222	0.447	0.432	B3F0A3_DANRE Sodium channel beta 1 subunit OS=Danio rerio OX=7955 GN=scn1bb PE=2 SV=1
5	Q07699	7.38e-53	171	218	0.488	0.482	SCN1B_HUMAN Sodium channel subunit beta-1 OS=Homo sapiens OX=9606 GN=SCN1B PE=1 SV=1
6	Q06W32	3.17e-52	169	221	0.428	0.416	Q06W32_DANRE Sodium channel subunit beta-1 precursor OS=Danio rerio OX=7955 GN=SCN1B PE=2 SV=1
7	Q00954	5.80e-51	166	218	0.484	0.477	SCN1B_RAT Sodium channel subunit beta-1 OS=Rattus norvegicus OX=10116 GN=Scn1b PE=1 SV=1
8	P97952	1.57e-50	165	218	0.479	0.472	SCN1B_MOUSE Sodium channel subunit beta-1 OS=Mus musculus OX=10090 GN=Scn1b PE=1 SV=1
9	Q06W35	1.87e-45	152	209	0.377	0.388	Q06W35_DANRE Sodium channel subunit beta-1 isoform X1 OS=Danio rerio OX=7955 GN=SCN1B PE=2 SV=1
10	A0A0R4IS04	4.45e-12	64.7	212	0.205	0.208	A0A0R4IS04_DANRE Myelin protein P0 isoform X2 OS=Danio rerio OX=7955 GN=p0 PE=1 SV=1
11	Q8JFG6	4.72e-12	64.7	203	0.177	0.187	Q8JFG6_DANRE Myelin protein P0 precursor OS=Danio rerio OX=7955 GN=p0 PE=1 SV=1
12	A0A2R8QN30	5.92e-12	64.7	228	0.177	0.167	A0A2R8QN30_DANRE Myelin protein P0 isoform X1 OS=Danio rerio OX=7955 GN=p0 PE=1 SV=1
13	Q3V3F6	8.69e-11	61.6	237	0.219	0.198	MPZL3_MOUSE Myelin protein zero-like protein 3 OS=Mus musculus OX=10090 GN=Mpzl3 PE=1 SV=3
14	Q6UWV2	1.37e-10	61.2	235	0.209	0.191	MPZL3_HUMAN Myelin protein zero-like protein 3 OS=Homo sapiens OX=9606 GN=MPZL3 PE=1 SV=1
15	P06907	2.18e-09	57.8	248	0.172	0.149	MYP0_RAT Myelin protein P0 OS=Rattus norvegicus OX=10116 GN=Mpz PE=1 SV=1
16	P27573	2.31e-09	57.8	248	0.172	0.149	MYP0_MOUSE Myelin protein P0 OS=Mus musculus OX=10090 GN=Mpz PE=1 SV=1
17	P25189	3.68e-09	57.4	248	0.172	0.149	MYP0_HUMAN Myelin protein P0 OS=Homo sapiens OX=9606 GN=MPZ PE=1 SV=1
18	O70255	2.21e-08	54.7	215	0.158	0.158	MPZL2_MOUSE Myelin protein zero-like protein 2 OS=Mus musculus OX=10090 GN=Mpzl2 PE=1 SV=1
19	O60487	4.64e-08	53.5	215	0.140	0.140	MPZL2_HUMAN Myelin protein zero-like protein 2 OS=Homo sapiens OX=9606 GN=MPZL2 PE=1 SV=1
20	Q6NW73	1.60e-07	52.0	215	0.116	0.116	Q6NW73_DANRE Myelin protein zero-like 3 OS=Danio rerio OX=7955 GN=zgc:85923 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05814 Ac76	3.6e+02	12.6	Orf76 (Ac76)
2	PF07679 I-set	4.1	18.9	Immunoglobulin I-set domain
3	PF00047 ig	2.3	19.8	Immunoglobulin domain
4	PF13895 Ig_2	0.76	21.4	Immunoglobulin domain
5	PF13927 Ig_3	0.078	24.9	Immunoglobulin domain
6	PF07686 V-set	1.9e-18	78.0	Immunoglobulin V-set domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9593.ENSGGOP00000007515

Rank	PPI partner	STRING score	Description
1	9593.ENSGGOP00000012641	0.857	Sodium channel protein
2	9593.ENSGGOP00000019928	0.833	Sodium channel, voltage-gated, type IV, beta subunit
3	9593.ENSGGOP00000024945	0.782	Sodium channel protein
4	9593.ENSGGOP00000008980	0.757	Sodium channel protein
5	9593.ENSGGOP00000028147	0.744	Sodium channel protein
6	9593.ENSGGOP00000016440	0.741	Sodium channel protein
7	9593.ENSGGOP00000002064	0.716	Sodium channel, voltage-gated, type II, beta subunit
8	9593.ENSGGOP00000025809	0.714	Sodium channel, voltage-gated, type IX, alpha subunit
9	9593.ENSGGOP00000002078	0.709	Sodium channel protein
10	9593.ENSGGOP00000007031	0.685	Glycerol-3-phosphate dehydrogenase 1-like
11	9593.ENSGGOP00000023417	0.685	Sodium channel protein
12	9593.ENSGGOP00000006310	0.682	Sodium channel protein
13	9593.ENSGGOP00000008890	0.671	Gamma-synuclein
14	9593.ENSGGOP00000011924	0.646	Potassium voltage-gated channel, Isk-related family, member 3
15	9593.ENSGGOP00000002713	0.630	Voltage-dependent L-type calcium channel subunit alpha
16	9593.ENSGGOP00000014383	0.611	Neurofascin
17	9593.ENSGGOP00000016934	0.587	Sodium leak channel, non-selective
18	9593.ENSGGOP00000023309	0.578	Dopey family member 1
19	9593.ENSGGOP00000010829	0.577	Voltage-dependent R-type calcium channel subunit alpha
20	9593.ENSGGOP00000010806	0.570	RAN guanine nucleotide release factor

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0044325	1.000	transmembrane transporter binding
GO:0005248	1.000	voltage-gated sodium channel activity
GO:0099106	0.997	ion channel regulator activity
GO:0017080	0.849	sodium channel regulator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.995	cellular process
GO:0050789	0.995	regulation of biological process
GO:0003008	0.995	system process
GO:0006810	0.987	transport
GO:0050794	0.986	regulation of cellular process
GO:0001508	0.986	action potential
GO:0008016	0.985	regulation of heart contraction
GO:0086001	0.983	cardiac muscle cell action potential
GO:0061337	0.983	cardiac conduction
GO:0030048	0.982	actin filament-based movement
GO:0007154	0.979	cell communication
GO:0030001	0.979	metal ion transport
GO:0086065	0.969	cell communication involved in cardiac conduction
GO:0006814	0.967	sodium ion transport
GO:0070252	0.965	actin-mediated cell contraction
GO:0060048	0.965	cardiac muscle contraction
GO:0003254	0.958	regulation of membrane depolarization
GO:0002027	0.957	regulation of heart rate
GO:0007267	0.923	cell-cell signaling
GO:0010959	0.915	regulation of metal ion transport
GO:1904062	0.890	regulation of monoatomic cation transmembrane transport
GO:0051899	0.872	membrane depolarization
GO:0048518	0.871	positive regulation of biological process
GO:0032412	0.867	regulation of monoatomic ion transmembrane transporter activity
GO:1902305	0.865	regulation of sodium ion transmembrane transport
GO:0098660	0.757	inorganic ion transmembrane transport
GO:0098655	0.646	monoatomic cation transmembrane transport
GO:0098662	0.645	inorganic cation transmembrane transport
GO:0051050	0.634	positive regulation of transport
GO:0032502	0.609	developmental process
GO:2000649	0.573	regulation of sodium ion transmembrane transporter activity
GO:0048856	0.534	anatomical structure development
GO:0050896	0.521	response to stimulus
GO:0007275	0.420	multicellular organism development
GO:0035725	0.420	sodium ion transmembrane transport
GO:0043270	0.309	positive regulation of monoatomic ion transport

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0034703	0.987	cation channel complex
GO:0098797	0.960	plasma membrane protein complex
GO:0034706	0.759	sodium channel complex
GO:0005622	0.708	intracellular anatomical structure
GO:0043226	0.678	organelle
GO:0005737	0.588	cytoplasm
GO:0043227	0.579	membrane-bounded organelle
GO:0043229	0.550	intracellular organelle
GO:0001518	0.395	voltage-gated sodium channel complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:34963	1.000	Na(+)(in) = Na(+)(out)

[back to server]