StarFunc result for job id Q9NY74

User Input

>input (926 residues)
MSRRRKHDDSPSPKKTPHKTVAAEECGSVVEPGRRRLRSARGSWPCGAREGPPGPVRQRE
QPPTAALCSKSNPEERYETPKRALKMDSLSSSFSSPNDPDGQNDIFWDQNSPLTKQLGKG
RKKQIYTTDSDEISHIVNRIAPQDEKPTTNSMLDMWIGETAIPCTPSVAKGKSRAKISCT
KLKTQSQEEELMKLAKQFDKNMEELDVIQEQNKRNYDFTQMISETEILSNYKDNIQMWSL
HNIVPEIDNATKKPIKGNTKISVANNQNSSQKPFDQIAEAAFNAIFDGSTQKCSGQLSQE
LPEAFWSTSNTTFVKTNALKEEKIITNETLVIEKLSNKTPRSLSSQVDTPIMTKSCVTSC
TKEPETSNKYIDAFTTSDFEDDWENLLGSEPFAMQNIDMPELFPSKTAHVTDQKEICTFN
SKTVKNTSRANTSPDARLGDSKVLQDLSSKTYDRELIDAEYRFSPNSNKSNKLSTGNKMK
FENSSNKIVIQDEIQNCIVTSNLTKIKEDILTNSTEASERKSALNTRYSNEQKNKCILNQ
SIKAPVNTDLFGSANLGSKTSVSNPNQTSASKVGSFFDDWNDPSFANEIIKACHQLDNTW
EADDVDDDLLYQACDDIERLTQQQDIRKDSKTSESICEINNNSEHGAKLTQQQDIRKDSK
TSESICEINNNSEHGAKNMFAISKQGSNLVQSKHLNPGSISVQTSLTNSSQIDKPMKMEK
GEMYGNSPRFLGATNLTMYSKISNCQINNLHVSYTNTDVPIQVNSSKLVLPGSSSLNVTS
DHMNTEITTYKKKLSTNQPCHKTVTDEAQSNLNTTVGFSKFTFTRMKNSQILSQFNQNCI
TGSMSDTKITQGVEKKKGVNPLLEEAVGQQSLVKLSESLKQSSKEEEEKNRKCSPEEIQR
KRQEALVRRMAKARASSVNAAPTSFL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9NY74	1.000	1.000	0.000	926	1.000	1.000	Q9NY74.pdb.gz	ETAA1_HUMAN Ewing's tumor-associated antigen 1 OS=Homo sapiens OX=9606 GN=ETAA1 PE=1 SV=2
2	AFDB:Q9USW1	0.044	0.050	5.118E-4	791	0.157	0.183	Q9USW1.pdb.gz	ATH1_SCHPO Ataxin-2 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ath1 PE=1 SV=1
3	AFDB:O82345	0.052	0.048	9.123E-3	1043	0.147	0.130	O82345.pdb.gz	BAG6_ARATH BAG family molecular chaperone regulator 6 OS=Arabidopsis thaliana OX=3702 GN=BAG6 PE=1 SV=1
4	AFDB:Q92585	0.074	0.068	1.185E-2	1016	0.134	0.122	Q92585.pdb.gz	MAML1_HUMAN Mastermind-like protein 1 OS=Homo sapiens OX=9606 GN=MAML1 PE=1 SV=3
5	AFDB:Q6DRQ0	0.037	0.037	1.266E-2	925	0.144	0.144	Q6DRQ0.pdb.gz
6	AFDB:A0A0S0WFC5	0.056	0.051	1.540E-2	1031	0.144	0.129	A0A0S0WFC5.pdb.gz	A0A0S0WFC5_DROME Sisters on the loose, isoform B OS=Drosophila melanogaster OX=7227 GN=solo PE=4 SV=1
7	AFDB:Q569L8	0.061	0.045	3.165E-2	1344	0.146	0.100	Q569L8.pdb.gz	CENPJ_MOUSE Centromere protein J OS=Mus musculus OX=10090 GN=Cenpj PE=2 SV=2
8	AFDB:O95886	0.045	0.044	3.379E-2	979	0.111	0.105	O95886.pdb.gz	DLGP3_HUMAN Disks large-associated protein 3 OS=Homo sapiens OX=9606 GN=DLGAP3 PE=1 SV=3
9	AFDB:Q711Q0	0.044	0.032	3.379E-2	1435	0.137	0.089	Q711Q0.pdb.gz	CEFIP_HUMAN Cardiac-enriched FHL2-interacting protein OS=Homo sapiens OX=9606 GN=CEFIP PE=1 SV=2
10	AFDB:F1M8L9	0.060	0.047	3.607E-2	1253	0.145	0.107	F1M8L9.pdb.gz	F1M8L9_RAT Rap guanine nucleotide exchange factor 1 OS=Rattus norvegicus OX=10116 GN=Rapgef1 PE=1 SV=4

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9NY74	0.0	1913	926	1.000	1.000	ETAA1_HUMAN Ewing's tumor-associated antigen 1 OS=Homo sapiens OX=9606 GN=ETAA1 PE=1 SV=2
2	Q86VL0	1.9	33.9	242	0.023	0.087	Q86VL0_HUMAN TCEA2 protein OS=Homo sapiens OX=9606 GN=TCEA2 PE=1 SV=1
3	M1WXG8	3.5	33.9	1624	0.024	0.014	M1WXG8_DANRE Pregnancy-associated plasma protein A, pappalysin 1b precursor OS=Danio rerio OX=7955 GN=papp-ab PE=2 SV=1
4	Q95VZ3	5.3	33.5	1050	0.026	0.023	CARML_DICDI Protein CARMIL OS=Dictyostelium discoideum OX=44689 GN=carmil PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15350 ETAA1	0	1362.0	Ewing's tumour-associated antigen 1 homologue

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000272342

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000363017	0.825	Replication protein A 32 kDa subunit
2	9606.ENSP00000323099	0.798	ATR-interacting protein
3	9606.ENSP00000260810	0.787	DNA topoisomerase 2-binding protein 1
4	9606.ENSP00000367193	0.768	F-box protein 48
5	9606.ENSP00000254719	0.764	Replication protein A 70 kDa DNA-binding subunit
6	9606.ENSP00000418960	0.757	Breast cancer type 1 susceptibility protein
7	9606.ENSP00000258774	0.689	Checkpoint protein HUS1
8	9606.ENSP00000263655	0.689	CB1 cannabinoid receptor-interacting protein 1
9	9606.ENSP00000343741	0.656	Serine/threonine-protein kinase ATR
10	9606.ENSP00000401764	0.644	Cbp/p300-interacting transactivator 1
11	9606.ENSP00000295121	0.642	Uncharacterized protein DKFZp434B156
12	9606.ENSP00000263657	0.641	RNA-binding protein PNO1
13	9606.ENSP00000317039	0.641	RecQ-mediated genome instability protein 1
14	9606.ENSP00000311360	0.612	Cell cycle checkpoint control protein RAD9A
15	9606.ENSP00000304923	0.602	Leucine-rich repeat-containing protein 28
16	9606.ENSP00000307004	0.601	Aprataxin and PNK-like factor
17	9606.ENSP00000371846	0.591	Deformed epidermal autoregulatory factor 1 homolog
18	9606.ENSP00000308944	0.589	Helicase-like transcription factor
19	9606.ENSP00000349823	0.581	SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1
20	9606.ENSP00000356124	0.578	Kelch domain containing 8A

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0043539	1.000	protein serine/threonine kinase activator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.990	cellular process
GO:0050896	0.987	response to stimulus
GO:0050794	0.987	regulation of cellular process
GO:0071704	0.986	organic substance metabolic process
GO:0044238	0.983	primary metabolic process
GO:0044237	0.983	cellular metabolic process
GO:0006807	0.978	nitrogen compound metabolic process
GO:0043170	0.975	macromolecule metabolic process
GO:0051716	0.972	cellular response to stimulus
GO:0006260	0.969	DNA replication
GO:0033554	0.956	cellular response to stress
GO:1901987	0.953	regulation of cell cycle phase transition
GO:0006974	0.951	cellular response to DNA damage stimulus
GO:0060255	0.950	regulation of macromolecule metabolic process
GO:0080090	0.939	regulation of primary metabolic process
GO:0051171	0.939	regulation of nitrogen compound metabolic process
GO:0031323	0.938	regulation of cellular metabolic process
GO:0006261	0.908	DNA-templated DNA replication
GO:0010604	0.906	positive regulation of macromolecule metabolic process
GO:2001020	0.901	regulation of response to DNA damage stimulus
GO:0031325	0.901	positive regulation of cellular metabolic process
GO:0051173	0.897	positive regulation of nitrogen compound metabolic process
GO:0009966	0.829	regulation of signal transduction
GO:0045005	0.783	DNA-templated DNA replication maintenance of fidelity
GO:0045859	0.704	regulation of protein kinase activity
GO:0033674	0.704	positive regulation of kinase activity
GO:0031297	0.668	replication fork processing
GO:0031401	0.657	positive regulation of protein modification process
GO:0001934	0.635	positive regulation of protein phosphorylation
GO:0045860	0.604	positive regulation of protein kinase activity
GO:1902531	0.590	regulation of intracellular signal transduction
GO:0071900	0.546	regulation of protein serine/threonine kinase activity
GO:0048519	0.447	negative regulation of biological process
GO:0019219	0.415	regulation of nucleobase-containing compound metabolic process
GO:0071902	0.409	positive regulation of protein serine/threonine kinase activity
GO:0048523	0.392	negative regulation of cellular process
GO:0006281	0.375	DNA repair
GO:1901976	0.309	regulation of cell cycle checkpoint

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0005654	1.000	nucleoplasm
GO:0043596	0.998	nuclear replication fork
GO:0032991	0.850	protein-containing complex
GO:0016604	0.329	nuclear body

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]