StarFunc result for job id Q9NY97

User Input

>input (397 residues)
MSVGRRRIKLLGILMMANVFIYFIMEVSKSSSQEKNGKGEVIIPKEKFWKISTPPEAYWN
REQEKLNRQYNPILSMLTNQTGEAGRLSNISHLNYCEPDLRVTSVVTGFNNLPDRFKDFL
LYLRCRNYSLLIDQPDKCAKKPFLLLAIKSLTPHFARRQAIRESWGQESNAGNQTVVRVF
LLGQTPPEDNHPDLSDMLKFESEKHQDILMWNYRDTFFNLSLKEVLFLRWVSTSCPDTEF
VFKGDDDVFVNTHHILNYLNSLSKTKAKDLFIGDVIHNAGPHRDKKLKYYIPEVVYSGLY
PPYAGGGGFLYSGHLALRLYHITDQVHLYPIDDVYTGMCLQKLGLVPEKHKGFRTFDIEE
KNKNNICSYVDLMLVHSRKPQEMIDIWSQLQSAHLKC

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9NY97	1.000	1.000	3.032E-84	397	1.000	1.000	Q9NY97.pdb.gz	B3GN2_HUMAN N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 2 OS=Homo sapiens OX=9606 GN=B3GNT2 PE=1 SV=2
2	AFDB:Q9Z222	0.950	0.950	1.150E-75	397	0.874	0.874	Q9Z222.pdb.gz	B3GN2_MOUSE N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 2 OS=Mus musculus OX=10090 GN=B3GNT2 PE=1 SV=3
3	PDB:7jhiC	0.828	0.992	2.533E-67	331	0.834	1.000	7jhiC.pdb.gz	Structures and mechanism of human glycosyltransferase beta 1,3-N-acetylglucosaminyltransferase 2 (B3GNT2), an important player in immune homeostasis.
4	AFDB:Q7Z7M8	0.740	0.740	9.661E-36	397	0.312	0.312	Q7Z7M8.pdb.gz	B3GN8_HUMAN UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 8 OS=Homo sapiens OX=9606 GN=B3GNT8 PE=1 SV=1
5	AFDB:Q8NFL0	0.708	0.701	2.222E-35	401	0.348	0.344	Q8NFL0.pdb.gz	B3GN7_HUMAN UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 7 OS=Homo sapiens OX=9606 GN=B3GNT7 PE=1 SV=1
6	AFDB:Q6ZMB0	0.723	0.746	2.819E-35	384	0.332	0.344	Q6ZMB0.pdb.gz	B3GN6_HUMAN Acetylgalactosaminyl-O-glycosyl-glycoprotein beta-1,3-N-acetylglucosaminyltransferase OS=Homo sapiens OX=9606 GN=B3GNT6 PE=1 SV=2
7	AFDB:Q9C0J1	0.698	0.732	3.046E-34	378	0.358	0.376	Q9C0J1.pdb.gz	B3GN4_HUMAN N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 4 OS=Homo sapiens OX=9606 GN=B3GNT4 PE=1 SV=1
8	AFDB:Q9Y2A9	0.723	0.770	3.233E-34	372	0.327	0.349	Q9Y2A9.pdb.gz	B3GN3_HUMAN N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 3 OS=Homo sapiens OX=9606 GN=B3GNT3 PE=1 SV=2
9	AFDB:Q8K0J2	0.737	0.737	3.642E-34	397	0.348	0.348	Q8K0J2.pdb.gz	B3GN7_MOUSE UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 7 OS=Mus musculus OX=10090 GN=B3gnt7 PE=2 SV=2
10	AFDB:O54904	0.635	0.768	3.332E-29	326	0.272	0.331	O54904.pdb.gz	B3GT1_MOUSE Beta-1,3-galactosyltransferase 1 OS=Mus musculus OX=10090 GN=B3galt1 PE=1 SV=2
11	AFDB:O43825	0.646	0.609	6.528E-28	422	0.264	0.249	O43825.pdb.gz	B3GT2_HUMAN Beta-1,3-galactosyltransferase 2 OS=Homo sapiens OX=9606 GN=B3GALT2 PE=1 SV=1
12	PDB:6fxrA	0.311	0.195	1.815E-6	700	0.081	0.046	6fxrA.pdb.gz	Molecular architecture of the multifunctional collagen lysyl hydroxylase and glycosyltransferase LH3.
13	PDB:4y63A	0.275	0.357	1.082E-5	282	0.076	0.106	4y63A.pdb.gz	Design of Glycosyltransferase Inhibitors: Serine Analogues as Pyrophosphate Surrogates?
14	PDB:7x8kB	0.256	0.272	6.842E-5	367	0.083	0.090	7x8kB.pdb.gz	Crystal Structures of Arabidopsis thaliana GDP-D-Mannose Pyrophosphorylase VITAMIN C DEFECTIVE 1.
15	PDB:4fixA	0.321	0.216	1.773E-4	629	0.081	0.051	4fixA.pdb.gz	Tetrameric Structure of the GlfT2 Galactofuranosyltransferase Reveals a Scaffold for the Assembly of Mycobacterial Arabinogalactan.
16	PDB:5vcmB	0.300	0.326	2.853E-4	358	0.108	0.120	5vcmB.pdb.gz	HumanN-acetylglucosaminyltransferase II substrate recognition uses a modular architecture that includes a convergent exosite.
17	PDB:3r2wC	0.258	0.232	3.620E-4	450	0.103	0.091	3r2wC.pdb.gz
18	PDB:7d72A	0.287	0.281	4.327E-4	407	0.078	0.076	7d72A.pdb.gz	Cryo-EM structures of human GMPPA-GMPPB complex reveal how cells maintain GDP-mannose homeostasis.
19	PDB:1ll0B	0.308	0.423	5.490E-4	267	0.081	0.120	1ll0B.pdb.gz
20	PDB:2gamC	0.421	0.443	9.379E-4	374	0.076	0.080	2gamC.pdb.gz	X-ray Crystal Structure of Leukocyte Type Core 2 beta1,6-N-Acetylglucosaminyltransferase: Evidence for a covergence of metal ion independent glycosyltransferase mechanism.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9NY97	0.0	830	397	1.000	1.000	B3GN2_HUMAN N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 2 OS=Homo sapiens OX=9606 GN=B3GNT2 PE=1 SV=2
2	Q9Z222	0.0	731	397	0.874	0.874	B3GN2_MOUSE N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 2 OS=Mus musculus OX=10090 GN=B3GNT2 PE=1 SV=3
3	Q8K0J2	6.15e-81	255	397	0.315	0.315	B3GN7_MOUSE UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 7 OS=Mus musculus OX=10090 GN=B3gnt7 PE=2 SV=2
4	Q8NFL0	1.13e-80	255	401	0.325	0.322	B3GN7_HUMAN UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 7 OS=Homo sapiens OX=9606 GN=B3GNT7 PE=1 SV=1
5	Q9C0J1	3.66e-78	248	378	0.338	0.354	B3GN4_HUMAN N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 4 OS=Homo sapiens OX=9606 GN=B3GNT4 PE=1 SV=1
6	Q6ZMB0	4.35e-77	245	384	0.310	0.320	B3GN6_HUMAN Acetylgalactosaminyl-O-glycosyl-glycoprotein beta-1,3-N-acetylglucosaminyltransferase OS=Homo sapiens OX=9606 GN=B3GNT6 PE=1 SV=2
7	Q9Y2A9	1.89e-72	233	372	0.315	0.336	B3GN3_HUMAN N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 3 OS=Homo sapiens OX=9606 GN=B3GNT3 PE=1 SV=2
8	Q7Z7M8	1.38e-64	213	397	0.300	0.300	B3GN8_HUMAN UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 8 OS=Homo sapiens OX=9606 GN=B3GNT8 PE=1 SV=1
9	O54904	6.39e-54	183	326	0.277	0.337	B3GT1_MOUSE Beta-1,3-galactosyltransferase 1 OS=Mus musculus OX=10090 GN=B3galt1 PE=1 SV=2
10	Q9Y5Z6	6.39e-54	183	326	0.277	0.337	B3GT1_HUMAN Beta-1,3-galactosyltransferase 1 OS=Homo sapiens OX=9606 GN=B3GALT1 PE=1 SV=1
11	O54905	8.97e-46	164	422	0.227	0.213	B3GT2_MOUSE Beta-1,3-galactosyltransferase 2 OS=Mus musculus OX=10090 GN=B3galt2 PE=1 SV=2
12	Q9JI67	1.31e-45	161	308	0.232	0.299	B3GT5_MOUSE Beta-1,3-galactosyltransferase 5 OS=Mus musculus OX=10090 GN=B3galt5 PE=2 SV=1
13	O43825	4.18e-45	162	422	0.227	0.213	B3GT2_HUMAN Beta-1,3-galactosyltransferase 2 OS=Homo sapiens OX=9606 GN=B3GALT2 PE=1 SV=1
14	Q9BYG0	2.11e-43	157	378	0.229	0.241	B3GN5_HUMAN Lactosylceramide 1,3-N-acetyl-beta-D-glucosaminyltransferase OS=Homo sapiens OX=9606 GN=B3GNT5 PE=1 SV=1
15	Q99NB2	3.06e-40	149	377	0.224	0.236	B3GN5_RAT Lactosylceramide 1,3-N-acetyl-beta-D-glucosaminyltransferase OS=Rattus norvegicus OX=10116 GN=B3gnt5 PE=2 SV=2
16	Q8BGY6	8.27e-40	147	376	0.229	0.242	B3GN5_MOUSE Lactosylceramide 1,3-N-acetyl-beta-D-glucosaminyltransferase OS=Mus musculus OX=10090 GN=B3gnt5 PE=2 SV=1
17	Q9Y2C3	7.46e-38	140	310	0.189	0.242	B3GT5_HUMAN Beta-1,3-galactosyltransferase 5 OS=Homo sapiens OX=9606 GN=B3GALT5 PE=1 SV=1
18	Q24157	2.20e-31	123	325	0.217	0.265	BRN_DROME Beta-1,3-galactosyltransferase brn OS=Drosophila melanogaster OX=7227 GN=brn PE=2 SV=2
19	Q920V1	2.49e-30	120	331	0.194	0.233	B3GL1_MOUSE UDP-GalNAc:beta-1,3-N-acetylgalactosaminyltransferase 1 OS=Mus musculus OX=10090 GN=B3galnt1 PE=2 SV=2
20	O75752	1.16e-29	119	331	0.202	0.242	B3GL1_HUMAN UDP-GalNAc:beta-1,3-N-acetylgalactosaminyltransferase 1 OS=Homo sapiens OX=9606 GN=B3GALNT1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04646 DUF604	35	15.2	Protein of unknown function, DUF604
2	PF02434 Fringe	15	16.5	Fringe-like
3	PF01762 Galactosyl_T	4e-37	139.5	Galactosyltransferase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000305595

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000420161	0.962	Beta-1,4-galactosyltransferase 4
2	9606.ENSP00000310696	0.959	Beta-1,4-galactosyltransferase 2
3	9606.ENSP00000369055	0.959	Beta-1,4-galactosyltransferase 1
4	9606.ENSP00000368917	0.955	N-acetyllactosaminide beta-1,6-N-acetylglucosaminyl-transferase
5	9606.ENSP00000312021	0.942	Galactoside 2-alpha-L-fucosyltransferase 1
6	9606.ENSP00000480428	0.933	Beta-1,4-galactosyltransferase 3
7	9606.ENSP00000480884	0.932	Type 2 lactosamine alpha-2,3-sialyltransferase
8	9606.ENSP00000466880	0.931	Alpha-(1,3)-fucosyltransferase 5
9	9606.ENSP00000302599	0.928	Alpha-(1,3)-fucosyltransferase 9
10	9606.ENSP00000305603	0.927	Galactoside 3(4)-L-fucosyltransferase
11	9606.ENSP00000351602	0.922	Alpha-(1,3)-fucosyltransferase 4
12	9606.ENSP00000387498	0.919	Galactoside 2-alpha-L-fucosyltransferase 2
13	9606.ENSP00000313398	0.916	Alpha-(1,3)-fucosyltransferase 6
14	9606.ENSP00000484824	0.913	Mucin-1
15	9606.ENSP00000266718	0.912	Lumican
16	9606.ENSP00000364700	0.911	Osteomodulin
17	9606.ENSP00000262551	0.909	Mimecan
18	9606.ENSP00000266719	0.909	Keratocan
19	9606.ENSP00000343924	0.907	Prolargin
20	9606.ENSP00000417498	0.905	Mucin-4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0008375	1.000	acetylglucosaminyltransferase activity
GO:0008499	1.000	UDP-galactose:beta-N-acetylglucosamine beta-1,3-galactosyltransferase activity
GO:0008532	0.461	N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0019538	0.997	protein metabolic process
GO:0044249	0.996	cellular biosynthetic process
GO:1901137	0.996	carbohydrate derivative biosynthetic process
GO:1901566	0.996	organonitrogen compound biosynthetic process
GO:0043412	0.995	macromolecule modification
GO:0044260	0.995	cellular macromolecule metabolic process
GO:0009059	0.995	macromolecule biosynthetic process
GO:0006486	0.987	protein glycosylation
GO:0005975	0.946	carbohydrate metabolic process
GO:0006023	0.938	aminoglycan biosynthetic process
GO:0006493	0.922	protein O-linked glycosylation
GO:0016051	0.898	carbohydrate biosynthetic process
GO:0006024	0.895	glycosaminoglycan biosynthetic process
GO:1903510	0.820	mucopolysaccharide metabolic process
GO:0044272	0.398	sulfur compound biosynthetic process
GO:0034637	0.316	cellular carbohydrate biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0000139	1.000	Golgi membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.4.1.-	1.000	Hexosyltransferases.
RHEA:14389	0.461	a beta-D-galactosyl-(1->4)-N-acetyl-beta-D-glucosaminyl derivative + UDP-N-acetyl-alpha-D-glucosamine = an N-acetyl-beta-D-glucosaminyl-(1->3)-beta-D-galactosyl-(1->4)-N-acetyl-beta-D-glucosaminyl derivative + H(+) + UDP
EC:2.4.1.149	0.461	N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase.

[back to server]