StarFunc result for job id Q9NYA1

User Input

>input (384 residues)
MDPAGGPRGVLPRPCRVLVLLNPRGGKGKALQLFRSHVQPLLAEAEISFTLMLTERRNHA
RELVRSEELGRWDALVVMSGDGLMHEVVNGLMERPDWETAIQKPLCSLPAGSGNALAASL
NHYAGYEQVTNEDLLTNCTLLLCRRLLSPMNLLSLHTASGLRLFSVLSLAWGFIADVDLE
SEKYRRLGEMRFTLGTFLRLAALRTYRGRLAYLPVGRVGSKTPASPVVVQQGPVDAHLVP
LEEPVPSHWTVVPDEDFVLVLALLHSHLGSEMFAAPMGRCAAGVMHLFYVRAGVSRAMLL
RLFLAMEKGRHMEYECPYLVYVPVVAFRLEPKDGKGVFAVDGELMVSEAVQGQVHPNYFW
MVSGCVEPPPSWKPQQMPPPEEPL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q53ZR5	0.993	0.993	8.511E-89	384	1.000	1.000	Q53ZR5.pdb.gz	Q53ZR5_HUMAN Sphingosine kinase 1 OS=Homo sapiens OX=9606 GN=SPHK1 PE=2 SV=1
2	PDB:4l02A	0.927	0.988	1.551E-78	360	0.927	0.989	4l02A.pdb.gz	Structure guided design of a series of sphingosine kinase (SphK) inhibitors.
3	AFDB:Q8CI15	0.930	0.934	3.515E-77	382	0.807	0.812	Q8CI15.pdb.gz	SPHK1_MOUSE Sphingosine kinase 1 OS=Mus musculus OX=10090 GN=Sphk1 PE=1 SV=1
4	AFDB:Q91V26	0.928	0.931	3.762E-75	383	0.781	0.783	Q91V26.pdb.gz	SPHK1_RAT Sphingosine kinase 1 OS=Rattus norvegicus OX=10116 GN=Sphk1 PE=1 SV=1
5	AFDB:Q9JIA7	0.865	0.542	1.775E-50	617	0.487	0.303	Q9JIA7.pdb.gz	SPHK2_MOUSE Sphingosine kinase 2 OS=Mus musculus OX=10090 GN=Sphk2 PE=1 SV=2
6	AFDB:M0R344	0.877	0.513	3.283E-50	663	0.492	0.285	M0R344.pdb.gz	M0R344_HUMAN Sphingosine kinase 2 OS=Homo sapiens OX=9606 GN=SPHK2 PE=1 SV=1
7	AFDB:A0A0R4IC42	0.843	0.376	9.846E-43	869	0.495	0.219	A0A0R4IC42.pdb.gz
8	AFDB:Q9VYY8	0.830	0.504	1.783E-39	641	0.354	0.212	Q9VYY8.pdb.gz	Q9VYY8_DROME RE64552p OS=Drosophila melanogaster OX=7227 GN=Sk1 PE=1 SV=1
9	AFDB:Q9VZW0	0.818	0.481	3.207E-38	661	0.352	0.204	Q9VZW0.pdb.gz	Q9VZW0_DROME LD11247p OS=Drosophila melanogaster OX=7227 GN=Sk2 PE=2 SV=3
10	AFDB:F2Y4A3	0.777	0.626	1.543E-36	481	0.294	0.235	F2Y4A3.pdb.gz	SPHK2_ARATH Sphingosine kinase 2 OS=Arabidopsis thaliana OX=3702 GN=SPHK2 PE=1 SV=1
11	AFDB:Q8L7L1	0.782	0.624	2.373E-36	485	0.310	0.245	Q8L7L1.pdb.gz	SPHK1_ARATH Sphingosine kinase 1 OS=Arabidopsis thaliana OX=3702 GN=SPHK1 PE=1 SV=1
12	PDB:7cgpB	0.643	0.709	4.234E-23	345	0.164	0.183	7cgpB.pdb.gz
13	PDB:2qv7A	0.574	0.708	2.884E-18	303	0.141	0.178	2qv7A.pdb.gz	Analysis of the Staphylococcus aureus DgkB Structure Reveals a Common Catalytic Mechanism for the Soluble Diacylglycerol Kinases.
14	PDB:2bonA	0.566	0.731	4.618E-15	287	0.143	0.192	2bonA.pdb.gz	Crystal Structure of Yegs, a Homologue to the Mammalian Diacylglycerol Kinases, Reveals a Novel Regulatory Metal Binding Site.
15	PDB:2bonB	0.507	0.698	2.583E-14	265	0.122	0.177	2bonB.pdb.gz	Crystal Structure of Yegs, a Homologue to the Mammalian Diacylglycerol Kinases, Reveals a Novel Regulatory Metal Binding Site.
16	PDB:7n29B	0.367	0.395	1.047E-8	350	0.128	0.140	7n29B.pdb.gz	Structure of human NADK2 reveals atypical assembly and regulation of NAD kinases from animal mitochondria.
17	PDB:1u0tB	0.366	0.473	7.963E-8	276	0.099	0.138	1u0tB.pdb.gz
18	PDB:1suwA	0.378	0.531	2.724E-7	249	0.086	0.133	1suwA.pdb.gz	Crystal Structures of an NAD Kinase from Archaeoglobus fulgidus in Complex with ATP, NAD, or NADP
19	PDB:1u0rD	0.398	0.482	3.483E-7	301	0.086	0.110	1u0rD.pdb.gz
20	PDB:2an1B	0.384	0.490	2.203E-6	281	0.083	0.114	2an1B.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q53ZR5	0.0	778	384	1.000	1.000	Q53ZR5_HUMAN Sphingosine kinase 1 OS=Homo sapiens OX=9606 GN=SPHK1 PE=2 SV=1
2	Q8CI15	0.0	625	382	0.807	0.812	SPHK1_MOUSE Sphingosine kinase 1 OS=Mus musculus OX=10090 GN=Sphk1 PE=1 SV=1
3	Q91V26	0.0	612	383	0.781	0.783	SPHK1_RAT Sphingosine kinase 1 OS=Rattus norvegicus OX=10116 GN=Sphk1 PE=1 SV=1
4	Q9NYA1	0.0	778	384	1.000	1.000	SPHK1_HUMAN Sphingosine kinase 1 OS=Homo sapiens OX=9606 GN=SPHK1 PE=1 SV=1
5	Q9JIA7	4.64e-68	228	617	0.315	0.196	SPHK2_MOUSE Sphingosine kinase 2 OS=Mus musculus OX=10090 GN=Sphk2 PE=1 SV=2
6	Q9NRA0	2.03e-65	221	654	0.326	0.191	SPHK2_HUMAN Sphingosine kinase 2 OS=Homo sapiens OX=9606 GN=SPHK2 PE=1 SV=2
7	M0R344	2.33e-65	221	663	0.326	0.189	M0R344_HUMAN Sphingosine kinase 2 OS=Homo sapiens OX=9606 GN=SPHK2 PE=1 SV=1
8	F2Y4A3	6.73e-54	187	481	0.312	0.249	SPHK2_ARATH Sphingosine kinase 2 OS=Arabidopsis thaliana OX=3702 GN=SPHK2 PE=1 SV=1
9	Q8L7L1	1.02e-52	184	485	0.320	0.254	SPHK1_ARATH Sphingosine kinase 1 OS=Arabidopsis thaliana OX=3702 GN=SPHK1 PE=1 SV=1
10	Q9VYY8	3.98e-43	160	641	0.245	0.147	Q9VYY8_DROME RE64552p OS=Drosophila melanogaster OX=7227 GN=Sk1 PE=1 SV=1
11	Q9VZW0	1.01e-41	157	661	0.250	0.145	Q9VZW0_DROME LD11247p OS=Drosophila melanogaster OX=7227 GN=Sk2 PE=2 SV=3
12	Q18425	3.15e-38	145	473	0.284	0.230	SPHK1_CAEEL Sphingosine kinase 1 OS=Caenorhabditis elegans OX=6239 GN=sphk-1 PE=1 SV=1
13	Q86KF9	9.39e-38	145	624	0.198	0.122	SPHKA_DICDI Sphingosine kinase A OS=Dictyostelium discoideum OX=44689 GN=sgkA PE=2 SV=2
14	M0R0E9	2.15e-34	129	255	0.151	0.227	M0R0E9_HUMAN Sphingosine kinase 2 OS=Homo sapiens OX=9606 GN=SPHK2 PE=1 SV=1
15	Q12246	4.92e-31	126	624	0.253	0.155	LCB4_YEAST Sphingoid long chain base kinase 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=LCB4 PE=1 SV=1
16	Q06147	5.70e-26	112	687	0.169	0.095	LCB5_YEAST Sphingoid long chain base kinase 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=LCB5 PE=1 SV=1
17	Q9LRB0	1.41e-21	99.0	763	0.159	0.080	LCBK1_ARATH Sphingoid long-chain bases kinase 1 OS=Arabidopsis thaliana OX=3702 GN=LCBK1 PE=1 SV=1
18	Q8TCT0	3.99e-21	97.1	537	0.169	0.121	CERK1_HUMAN Ceramide kinase OS=Homo sapiens OX=9606 GN=CERK PE=1 SV=1
19	Q8K4Q7	1.78e-19	92.0	531	0.177	0.128	CERK1_MOUSE Ceramide kinase OS=Mus musculus OX=10090 GN=Cerk PE=1 SV=2
20	Q6B516	2.30e-19	92.4	760	0.112	0.057	SPHKB_DICDI Sphingosine kinase B OS=Dictyostelium discoideum OX=44689 GN=sgkB PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00781 DAGK_cat	2.7e-25	99.8	Diacylglycerol kinase catalytic domain
2	PF19279 YegS_C	0.16	23.3	YegS C-terminal NAD kinase beta sandwich-like domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000313681

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000428924	0.994	Tyrosine-protein kinase Lyn
2	9606.ENSP00000247668	0.986	TNF receptor-associated factor 2
3	9606.ENSP00000362298	0.984	Sphingosine-1-phosphate lyase 1
4	9606.ENSP00000247225	0.979	Sphingosine-1-phosphate phosphatase 1
5	9606.ENSP00000315137	0.979	Sphingosine-1-phosphate phosphatase 2
6	9606.ENSP00000375909	0.975	A-kinase anchor protein SPHKAP
7	9606.ENSP00000378897	0.975	Neutral ceramidase
8	9606.ENSP00000376453	0.971	Ceramide synthase 6
9	9606.ENSP00000371152	0.970	Acid ceramidase
10	9606.ENSP00000457421	0.968	Platelet endothelial cell adhesion molecule
11	9606.ENSP00000271688	0.967	Ceramide synthase 2
12	9606.ENSP00000434480	0.965	Alkaline ceramidase 3
13	9606.ENSP00000251363	0.964	Ceramide synthase 4
14	9606.ENSP00000316476	0.964	Sphingolipid delta(4)-desaturase DES1
15	9606.ENSP00000325485	0.964	Ceramide synthase 5
16	9606.ENSP00000342609	0.962	Alkaline ceramidase 2
17	9606.ENSP00000301452	0.961	Alkaline ceramidase 1
18	9606.ENSP00000307126	0.958	Sphingolipid delta(4)-desaturase/C4-monooxygenase DES2
19	9606.ENSP00000284382	0.956	Ceramide synthase 3
20	9606.ENSP00000360296	0.954	Phospholipid phosphatase 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0017050	0.999	D-erythro-sphingosine kinase activity
GO:0005488	0.997	binding
GO:0005515	0.994	protein binding
GO:0001727	0.984	lipid kinase activity
GO:0016773	0.968	phosphotransferase activity, alcohol group as acceptor
GO:0043167	0.596	ion binding
GO:0008481	0.467	sphinganine kinase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.985	regulation of cellular process
GO:0009987	0.983	cellular process
GO:0071704	0.980	organic substance metabolic process
GO:0050896	0.971	response to stimulus
GO:0044237	0.960	cellular metabolic process
GO:0044238	0.951	primary metabolic process
GO:0051716	0.951	cellular response to stimulus
GO:0048518	0.851	positive regulation of biological process
GO:0007154	0.810	cell communication
GO:0009058	0.777	biosynthetic process
GO:1901564	0.773	organonitrogen compound metabolic process
GO:0019222	0.733	regulation of metabolic process
GO:0042221	0.705	response to chemical
GO:0048522	0.668	positive regulation of cellular process
GO:0044249	0.649	cellular biosynthetic process
GO:0044255	0.639	cellular lipid metabolic process
GO:0031323	0.632	regulation of cellular metabolic process
GO:1901576	0.614	organic substance biosynthetic process
GO:0048519	0.605	negative regulation of biological process
GO:0080090	0.599	regulation of primary metabolic process
GO:0007165	0.595	signal transduction
GO:0051171	0.557	regulation of nitrogen compound metabolic process
GO:0060255	0.529	regulation of macromolecule metabolic process
GO:0006665	0.517	sphingolipid metabolic process
GO:0048523	0.414	negative regulation of cellular process
GO:0008610	0.373	lipid biosynthetic process
GO:0009893	0.357	positive regulation of metabolic process
GO:0048583	0.350	regulation of response to stimulus
GO:0070887	0.312	cellular response to chemical stimulus
GO:0010604	0.305	positive regulation of macromolecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	0.999	membrane
GO:0012505	0.997	endomembrane system
GO:0005829	0.997	cytosol
GO:0043231	0.997	intracellular membrane-bounded organelle
GO:0071944	0.995	cell periphery
GO:0005886	0.994	plasma membrane
GO:0031982	0.847	vesicle
GO:0031090	0.748	organelle membrane
GO:0031410	0.740	cytoplasmic vesicle
GO:0005634	0.532	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:35847	0.999	ATP + sphing-4-enine = ADP + H(+) + sphing-4-enine 1-phosphate
EC:2.7.1.-	0.968	Phosphotransferases with an alcohol group as acceptor.
RHEA:15465	0.467	ATP + sphinganine = ADP + H(+) + sphinganine 1-phosphate
EC:2.7.1.91	0.467	sphingosine kinase.

[back to server]