StarFunc result for job id Q9NYB0

User Input

>input (399 residues)
MAEAMDLGKDPNGPTHSSTLFVRDDGSSMSFYVRPSPAKRRLSTLILHGGGTVCRVQEPG
AVLLAQPGEALAEASGDFISTQYILDCVERNERLELEAYRLGPASAADTGSEAKPGALAE
GAAEPEPQRHAGRIAFTDADDVAILTYVKENARSPSSVTGNALWKAMEKSSLTQHSWQSL
KDRYLKHLRGQEHKYLLGDAPVSPSSQKLKRKAEEDPEAADSGEPQNKRTPDLPEEEYVK
EEIQENEEAVKKMLVEATREFEEVVVDESPPDFEIHITMCDDDPPTPEEDSETQPDEEEE
EEEEKVSQPEVGAAIKIIRQLMEKFNLDLSTVTQAFLKNSGELEATSAFLASGQRADGYP
IWSRQDDIDLQKDDEDTREALVKKFGAQNVARRIEFRKK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9NYB0	1.000	1.000	8.954E-60	399	1.000	1.000	Q9NYB0.pdb.gz	TE2IP_HUMAN Telomeric repeat-binding factor 2-interacting protein 1 OS=Homo sapiens OX=9606 GN=TERF2IP PE=1 SV=1
2	AFDB:Q91VL8	0.658	0.667	1.465E-47	393	0.850	0.863	Q91VL8.pdb.gz	TE2IP_MOUSE Telomeric repeat-binding factor 2-interacting protein 1 OS=Mus musculus OX=10090 GN=Terf2ip PE=1 SV=1
3	AFDB:Q7T0L4	0.314	0.371	4.806E-25	329	0.373	0.453	Q7T0L4.pdb.gz	TE2IP_CHICK Telomeric repeat-binding factor 2-interacting protein 1 OS=Gallus gallus OX=9031 GN=TERF2IP PE=1 SV=1
4	AFDB:Q7TT79	0.184	0.099	3.696E-3	822	0.098	0.047	Q7TT79.pdb.gz	MCPH1_MOUSE Microcephalin OS=Mus musculus OX=10090 GN=Mcph1 PE=1 SV=1
5	AFDB:Q92547	0.169	0.053	8.916E-3	1522	0.140	0.037	Q92547.pdb.gz	TOPB1_HUMAN DNA topoisomerase 2-binding protein 1 OS=Homo sapiens OX=9606 GN=TOPBP1 PE=1 SV=3
6	AFDB:Q9U7C9	0.191	0.107	2.512E-2	756	0.098	0.052	Q9U7C9.pdb.gz	NUCMR_DICDI Nucleomorphin OS=Dictyostelium discoideum OX=44689 GN=numA PE=1 SV=2
7	AFDB:A3EWL3	0.179	0.071	2.786E-2	1105	0.090	0.033	A3EWL3.pdb.gz	REV1_ARATH DNA repair protein REV1 OS=Arabidopsis thaliana OX=3702 GN=REV1 PE=2 SV=1
8	AFDB:P12689	0.185	0.080	6.721E-2	985	0.090	0.037	P12689.pdb.gz	REV1_YEAST DNA repair protein REV1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=REV1 PE=1 SV=2
9	AFDB:Q9FJS9	0.140	0.215	8.268E-2	233	0.068	0.116	Q9FJS9.pdb.gz	Q9FJS9_ARATH At5g56840 OS=Arabidopsis thaliana OX=3702 GN=MIK19.31 PE=1 SV=1
10	PDB:7lsyY	0.176	0.085	1.131E-1	855	0.030	0.014	7lsyY.pdb.gz	Structural basis of long-range to short-range synaptic transition in NHEJ.
11	PDB:7nacn	0.170	0.161	1.625E-1	425	0.100	0.094	7nacn.pdb.gz	Sequence-specific remodeling of a topologically complex RNP substrate by Spb4.
12	PDB:7ohpn	0.159	0.199	1.898E-1	314	0.068	0.086	7ohpn.pdb.gz	Analysis of subunit folding contribution of three yeast large ribosomal subunit proteins required for stabilisation and processing of intermediate nuclear rRNA precursors.
13	AFDB:Q6R0G4	0.121	0.161	3.018E-1	293	0.093	0.126	Q6R0G4.pdb.gz	RVE4_ARATH Protein REVEILLE 4 OS=Arabidopsis thaliana OX=3702 GN=RVE4 PE=1 SV=1
14	PDB:7p5zG	0.140	0.243	6.927E-1	213	0.038	0.070	7p5zG.pdb.gz	Structural mechanism for the selective phosphorylation of DNA-loaded MCM double hexamers by the Dbf4-dependent kinase.
15	PDB:7pt6I	0.141	0.162	1.760	341	0.033	0.038	7pt6I.pdb.gz	The structural basis of Cdc7-Dbf4 kinase dependent targeting and phosphorylation of the MCM2-7 double hexamer.
16	PDB:4v6wAR	0.106	0.281	2.805	120	0.035	0.117	4v6wAR.pdb.gz	Structures of the human and Drosophila 80S ribosome.
17	PDB:7qwqt	0.087	0.539	2.805	47	0.023	0.191	7qwqt.pdb.gz	Mechanism of signal sequence handover from NAC to SRP on ribosomes during ER-protein targeting.
18	PDB:1c9yA	0.085	0.102	2.954	321	0.035	0.044	1c9yA.pdb.gz	Crystal structure of human ornithine transcarbamylase complexed with carbamoyl phosphate and L-norvaline at 1.9 A resolution.
19	PDB:6lthO	0.117	0.142	3.634	325	0.035	0.043	6lthO.pdb.gz	Structure of nucleosome-bound human BAF complex.
20	PDB:1qpnA	0.065	0.086	4.245	284	0.030	0.042	1qpnA.pdb.gz	Crystal structure of quinolinic acid phosphoribosyltransferase from Mycobacterium tuberculosis: a potential TB drug target.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q91VL8	0.0	644	393	0.850	0.863	TE2IP_MOUSE Telomeric repeat-binding factor 2-interacting protein 1 OS=Mus musculus OX=10090 GN=Terf2ip PE=1 SV=1
2	Q9NYB0	0.0	816	399	1.000	1.000	TE2IP_HUMAN Telomeric repeat-binding factor 2-interacting protein 1 OS=Homo sapiens OX=9606 GN=TERF2IP PE=1 SV=1
3	Q7T0L4	3.49e-79	249	329	0.383	0.465	TE2IP_CHICK Telomeric repeat-binding factor 2-interacting protein 1 OS=Gallus gallus OX=9031 GN=TERF2IP PE=1 SV=1
4	A0A1D8PIK2	4.21e-04	44.7	430	0.068	0.063	A0A1D8PIK2_CANAL DNA-binding protein RAP1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=RAP1 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF16589 BRCT_2	3.9e-13	60.9	BRCT domain, a BRCA1 C-terminus domain
2	PF08914 Myb_DNA-bind_2	3.7e-28	108.8	Rap1 Myb domain
3	PF13921 Myb_DNA-bind_6	49	15.6	Myb-like DNA-binding domain
4	PF11626 Rap1_C	4.3e-09	47.6	TRF2-interacting telomeric protein/Rap1 - C terminal domain
5	PF17484 TbpB_A	98	15.2	N-Lobe handle Tf-binding protein B

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000300086

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000254942	0.999	Telomeric repeat-binding factor 2
2	9606.ENSP00000267415	0.999	TERF1-interacting nuclear factor 2
3	9606.ENSP00000483117	0.997	Adrenocortical dysplasia protein homolog
4	9606.ENSP00000350249	0.995	Protection of telomeres protein 1
5	9606.ENSP00000276603	0.994	Telomeric repeat-binding factor 1
6	9606.ENSP00000325863	0.991	Double-strand break repair protein MRE11
7	9606.ENSP00000368100	0.988	DNA repair protein RAD50
8	9606.ENSP00000265433	0.983	Nibrin
9	9606.ENSP00000352257	0.945	X-ray repair cross-complementing protein 6
10	9606.ENSP00000298139	0.933	Werner syndrome ATP-dependent helicase
11	9606.ENSP00000377390	0.929	Serine/threonine-protein phosphatase 6 regulatory subunit 3
12	9606.ENSP00000305480	0.915	Flap endonuclease 1
13	9606.ENSP00000328174	0.908	ATP-dependent DNA helicase PIF1
14	9606.ENSP00000347232	0.904	Bloom syndrome protein
15	9606.ENSP00000263274	0.901	DNA ligase 1
16	9606.ENSP00000266970	0.901	Cyclin-dependent kinase 2
17	9606.ENSP00000375978	0.901	X-ray repair cross-complementing protein 5
18	9606.ENSP00000255465	0.900	Cyclin-A1
19	9606.ENSP00000274026	0.900	Cyclin-A2
20	9606.ENSP00000382379	0.900	Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0019902	1.000	phosphatase binding
GO:0043047	1.000	single-stranded telomeric DNA binding
GO:0098505	0.980	G-rich strand telomeric DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0044237	0.991	cellular metabolic process
GO:0044238	0.990	primary metabolic process
GO:0050794	0.990	regulation of cellular process
GO:0006807	0.986	nitrogen compound metabolic process
GO:0043170	0.985	macromolecule metabolic process
GO:0090304	0.982	nucleic acid metabolic process
GO:0071840	0.976	cellular component organization or biogenesis
GO:0019222	0.969	regulation of metabolic process
GO:0016043	0.964	cellular component organization
GO:0060255	0.964	regulation of macromolecule metabolic process
GO:0080090	0.950	regulation of primary metabolic process
GO:0051171	0.950	regulation of nitrogen compound metabolic process
GO:0051128	0.948	regulation of cellular component organization
GO:0031323	0.948	regulation of cellular metabolic process
GO:0071897	0.945	DNA biosynthetic process
GO:0006278	0.932	RNA-templated DNA biosynthetic process
GO:0033044	0.929	regulation of chromosome organization
GO:0031325	0.921	positive regulation of cellular metabolic process
GO:1903506	0.911	regulation of nucleic acid-templated transcription
GO:0006996	0.895	organelle organization
GO:0051173	0.892	positive regulation of nitrogen compound metabolic process
GO:0045934	0.889	negative regulation of nucleobase-containing compound metabolic process
GO:0010604	0.873	positive regulation of macromolecule metabolic process
GO:0051052	0.871	regulation of DNA metabolic process
GO:0051276	0.870	chromosome organization
GO:0010605	0.869	negative regulation of macromolecule metabolic process
GO:0051179	0.862	localization
GO:0051053	0.862	negative regulation of DNA metabolic process
GO:0010468	0.858	regulation of gene expression
GO:0032200	0.831	telomere organization
GO:0000723	0.819	telomere maintenance
GO:0006974	0.792	cellular response to DNA damage stimulus
GO:0007004	0.769	telomere maintenance via telomerase
GO:0033036	0.744	macromolecule localization
GO:0051641	0.719	cellular localization
GO:0032204	0.711	regulation of telomere maintenance
GO:0065009	0.688	regulation of molecular function
GO:0033365	0.655	protein localization to organelle
GO:0034502	0.647	protein localization to chromosome
GO:0051129	0.645	negative regulation of cellular component organization
GO:0048583	0.630	regulation of response to stimulus
GO:0044093	0.586	positive regulation of molecular function
GO:0009966	0.572	regulation of signal transduction
GO:0006355	0.572	regulation of DNA-templated transcription
GO:0048584	0.555	positive regulation of response to stimulus
GO:0009967	0.538	positive regulation of signal transduction
GO:1902531	0.532	regulation of intracellular signal transduction
GO:0010639	0.532	negative regulation of organelle organization
GO:2001251	0.474	negative regulation of chromosome organization
GO:1902533	0.468	positive regulation of intracellular signal transduction
GO:0051246	0.430	regulation of protein metabolic process
GO:0016233	0.421	telomere capping
GO:0031399	0.382	regulation of protein modification process
GO:0045935	0.358	positive regulation of nucleobase-containing compound metabolic process
GO:0050790	0.315	regulation of catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0000781	1.000	chromosome, telomeric region
GO:0005654	1.000	nucleoplasm
GO:0032991	0.999	protein-containing complex
GO:0005829	0.985	cytosol
GO:0032993	0.912	protein-DNA complex
GO:0140513	0.905	nuclear protein-containing complex
GO:0016604	0.791	nuclear body
GO:0000228	0.701	nuclear chromosome
GO:0000782	0.686	telomere cap complex
GO:0000783	0.675	nuclear telomere cap complex
GO:0070187	0.476	shelterin complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]