StarFunc result for job id Q9NYB9

User Input

>input (513 residues)
MAELQMLLEEEIPGGRRALFDSYTNLERVADYCENNYIQSADKQRALEETKAYTTQSLAS
VAYLINTLANNVLQMLDIQASQLRRMESSINHISQTVDIHKEKVARREIGILTTNKNTSR
THKIIAPANLERPVRYIRKPIDYTILDDIGHGVKWLLRFKVSTQNMKMGGLPRTTPPTQK
PPSPPMSGKGTLGRHSPYRTLEPVRPPVVPNDYVPSPTRNMAPSQQSPVRTASVNQRNRT
YSSSGSSGGSHPSSRSSSRENSGSGSVGVPIAVPTPSPPSVFPAPAGSAGTPPLPATSAS
APAPLVPATVPSSTAPNAAAGGAPNLADGFTSPTPPVVSSTPPTGHPVQFYSMNRPASRH
TPPTIGGSLPYRRPPSITSQTSLQNQMNGGPFYSQNPVSDTPPPPPPVEEPVFDESPPPP
PPPEDYEEEEAAVVEYSDPYAEEDPPWAPRSYLEKVVAIYDYTKDKEDELSFQEGAIIYV
IKKNDDGWYEGVMNGVTGLFPGNYVESIMHYSE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9NYB9	1.000	1.000	6.402E-75	513	1.000	1.000	Q9NYB9.pdb.gz	ABI2_HUMAN Abl interactor 2 OS=Homo sapiens OX=9606 GN=ABI2 PE=1 SV=1
2	AFDB:F8WAL6	0.278	0.265	5.414E-69	542	0.992	0.939	F8WAL6.pdb.gz	F8WAL6_HUMAN Abl interactor 2 OS=Homo sapiens OX=9606 GN=ABI2 PE=1 SV=3
3	AFDB:E7EW77	0.300	0.317	1.388E-66	480	0.930	0.994	E7EW77.pdb.gz	E7EW77_HUMAN Abl interactor 2 OS=Homo sapiens OX=9606 GN=ABI2 PE=1 SV=1
4	AFDB:P62484	0.421	0.475	4.873E-63	446	0.864	0.993	P62484.pdb.gz	ABI2_MOUSE Abl interactor 2 OS=Mus musculus OX=10090 GN=Abi2 PE=1 SV=1
5	AFDB:E9PEZ7	0.320	0.349	8.566E-62	458	0.887	0.993	E9PEZ7.pdb.gz	E9PEZ7_HUMAN Abl interactor 2 OS=Homo sapiens OX=9606 GN=ABI2 PE=1 SV=1
6	AFDB:Q8IZP0	0.478	0.481	1.070E-50	508	0.655	0.661	Q8IZP0.pdb.gz	ABI1_HUMAN Abl interactor 1 OS=Homo sapiens OX=9606 GN=ABI1 PE=1 SV=4
7	AFDB:Q8CBW3	0.486	0.514	6.520E-50	481	0.639	0.682	Q8CBW3.pdb.gz	ABI1_MOUSE Abl interactor 1 OS=Mus musculus OX=10090 GN=Abi1 PE=1 SV=3
8	AFDB:Q66IV2	0.310	0.315	5.098E-49	503	0.635	0.648	Q66IV2.pdb.gz	Q66IV2_XENLA Abl interactor 1 S homeolog OS=Xenopus laevis OX=8355 GN=abi1.S PE=2 SV=1
9	AFDB:A0A0B4K774	0.334	0.355	7.330E-33	477	0.404	0.434	A0A0B4K774.pdb.gz	A0A0B4K774_DROME Abelson interacting protein, isoform D OS=Drosophila melanogaster OX=7227 GN=Abi PE=1 SV=1
10	AFDB:Q9P2A4	0.311	0.422	1.223E-28	366	0.341	0.478	Q9P2A4.pdb.gz	ABI3_HUMAN ABI gene family member 3 OS=Homo sapiens OX=9606 GN=ABI3 PE=1 SV=2
11	PDB:4n78F	0.284	0.867	6.459E-22	156	0.302	0.994	4n78F.pdb.gz	The WAVE Regulatory Complex Links Diverse Receptors to the Actin Cytoskeleton.
12	PDB:2dybA	0.106	0.182	8.726E-6	298	0.035	0.060	2dybA.pdb.gz
13	PDB:3qwyA	0.115	0.339	9.288E-6	170	0.037	0.112	3qwyA.pdb.gz
14	PDB:3ehqA	0.111	0.302	1.529E-5	182	0.045	0.126	3ehqA.pdb.gz
15	PDB:1griA	0.110	0.263	1.962E-5	211	0.039	0.095	1griA.pdb.gz
16	PDB:1k9aB	0.102	0.118	2.679E-5	441	0.029	0.034	1k9aB.pdb.gz
17	PDB:2h8hA	0.098	0.113	9.318E-5	445	0.035	0.040	2h8hA.pdb.gz	N-(5-chloro-1,3-benzodioxol-4-yl)-7-[2-(4-methylpiperazin-1-yl)ethoxy]-5- (tetrahydro-2H-pyran-4-yloxy)quinazolin-4-amine, a novel, highly selective, orally available, dual-specific c-Src/Abl kinase inhibitor.
18	PDB:1k0xA	0.107	0.473	1.968E-4	108	0.029	0.139	1k0xA.pdb.gz
19	PDB:2lqnA	0.109	0.182	2.525E-4	303	0.039	0.066	2lqnA.pdb.gz
20	PDB:6x5hA	0.114	0.125	2.525E-4	467	0.037	0.041	6x5hA.pdb.gz	Characterizing human alpha-1,6-fucosyltransferase (FUT8) substrate specificity and structural similarities with related fucosyltransferases.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0C4DG21	0.0	1006	507	0.982	0.994	A0A0C4DG21_HUMAN Abl interactor 2 OS=Homo sapiens OX=9606 GN=ABI2 PE=1 SV=1
2	E7EP65	0.0	969	486	0.942	0.994	E7EP65_HUMAN Abl interactor 2 (Fragment) OS=Homo sapiens OX=9606 GN=ABI2 PE=1 SV=1
3	E7EW77	0.0	793	480	0.930	0.994	E7EW77_HUMAN Abl interactor 2 OS=Homo sapiens OX=9606 GN=ABI2 PE=1 SV=1
4	F8WAL6	0.0	1012	542	0.994	0.941	F8WAL6_HUMAN Abl interactor 2 OS=Homo sapiens OX=9606 GN=ABI2 PE=1 SV=3
5	P62484	0.0	669	446	0.842	0.969	ABI2_MOUSE Abl interactor 2 OS=Mus musculus OX=10090 GN=Abi2 PE=1 SV=1
6	Q66IV2	0.0	548	503	0.651	0.664	Q66IV2_XENLA Abl interactor 1 S homeolog OS=Xenopus laevis OX=8355 GN=abi1.S PE=2 SV=1
7	Q8IZP0	0.0	550	508	0.659	0.665	ABI1_HUMAN Abl interactor 1 OS=Homo sapiens OX=9606 GN=ABI1 PE=1 SV=4
8	Q9NYB9	0.0	1035	513	1.000	1.000	ABI2_HUMAN Abl interactor 2 OS=Homo sapiens OX=9606 GN=ABI2 PE=1 SV=1
9	Q8CBW3	1.40e-125	377	481	0.415	0.443	ABI1_MOUSE Abl interactor 1 OS=Mus musculus OX=10090 GN=Abi1 PE=1 SV=3
10	Q9QZM5	2.28e-121	366	476	0.411	0.443	ABI1_RAT Abl interactor 1 OS=Rattus norvegicus OX=10116 GN=Abi1 PE=1 SV=3
11	E9PEZ7	2.03e-109	335	458	0.322	0.360	E9PEZ7_HUMAN Abl interactor 2 OS=Homo sapiens OX=9606 GN=ABI2 PE=1 SV=1
12	A0A0B4K774	6.97e-56	196	477	0.195	0.210	A0A0B4K774_DROME Abelson interacting protein, isoform D OS=Drosophila melanogaster OX=7227 GN=Abi PE=1 SV=1
13	A0A0B4KH51	7.38e-56	196	472	0.195	0.212	A0A0B4KH51_DROME Abelson interacting protein, isoform C OS=Drosophila melanogaster OX=7227 GN=Abi PE=1 SV=1
14	Q9Y0S9	7.54e-56	196	473	0.195	0.211	Q9Y0S9_DROME Abelson interacting protein, isoform A OS=Drosophila melanogaster OX=7227 GN=Abi PE=1 SV=1
15	Q9P2A4	9.26e-55	190	366	0.207	0.290	ABI3_HUMAN ABI gene family member 3 OS=Homo sapiens OX=9606 GN=ABI3 PE=1 SV=2
16	Q8BYZ1	2.37e-48	172	367	0.189	0.264	ABI3_MOUSE ABI gene family member 3 OS=Mus musculus OX=10090 GN=Abi3 PE=1 SV=3
17	Q10929	1.81e-43	162	469	0.150	0.164	Q10929_CAEEL SH3 domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=abi-1 PE=1 SV=2
18	Q9NZM3	1.51e-12	72.8	1697	0.057	0.017	ITSN2_HUMAN Intersectin-2 OS=Homo sapiens OX=9606 GN=ITSN2 PE=1 SV=3
19	Q9Z0R6	1.62e-11	69.7	1659	0.053	0.016	ITSN2_MOUSE Intersectin-2 OS=Mus musculus OX=10090 GN=Itsn2 PE=1 SV=2
20	Q55FT9	6.36e-11	65.9	332	0.066	0.102	ABIA_DICDI Abl interactor homolog OS=Dictyostelium discoideum OX=44689 GN=abiA PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07815 Abi_HHR	2.6e-31	118.9	Abl-interactor HHR
2	PF16886 ATP-synt_ab_Xtn	3.8e+02	12.3	ATPsynthase alpha/beta subunit N-term extension
3	PF00018 SH3_1	1.8e-12	58.0	SH3 domain
4	PF07653 SH3_2	6.9e-09	46.7	Variant SH3 domain
5	PF14604 SH3_9	1.1e-12	59.0	Variant SH3 domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9785.ENSLAFP00000012661

Rank	PPI partner	STRING score	Description
1	9785.ENSLAFP00000009740	0.995	BRICK1, SCAR/WAVE actin-nucleating complex subunit
2	9785.ENSLAFP00000022265	0.995	NCK-associated protein 1
3	9785.ENSLAFP00000007450	0.991	Belongs to the CYFIP family.
4	9785.ENSLAFP00000026827	0.989	WAS protein family, member 1
5	9785.ENSLAFP00000027575	0.989	Uncharacterized protein
6	9785.ENSLAFP00000005872	0.973	Tyrosine-protein kinase
7	9785.ENSLAFP00000002378	0.969	Belongs to the CYFIP family.
8	9785.ENSLAFP00000005076	0.933	WAS protein family, member 2
9	9785.ENSLAFP00000011053	0.896	Actin-related protein 2/3 complex subunit 5
10	9785.ENSLAFP00000021142	0.887	Wiskott-Aldrich syndrome-like
11	9785.ENSLAFP00000015415	0.883	WAS protein family, member 3
12	9785.ENSLAFP00000009271	0.871	NCK-associated protein 1-like
13	9785.ENSLAFP00000004477	0.869	Tyrosine-protein kinase
14	9785.ENSLAFP00000008604	0.865	ARP2 actin-related protein 2 homolog (yeast)
15	9785.ENSLAFP00000022280	0.858	Wiskott-Aldrich syndrome
16	9785.ENSLAFP00000005173	0.855	Actin-related protein 2/3 complex subunit 3
17	9785.ENSLAFP00000010737	0.848	Ras-related C3 botulinum toxin substrate 1 (rho family, small GTP binding protein Rac1)
18	9785.ENSLAFP00000006235	0.837	Arp2/3 complex 34 kDa subunit
19	9785.ENSLAFP00000013684	0.807	Epidermal growth factor receptor pathway substrate 8
20	9785.ENSLAFP00000023239	0.807	Actin-related protein 2/3 complex subunit 4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0019904	0.989	protein domain specific binding
GO:0017124	0.983	SH3 domain binding
GO:0035591	0.981	signaling adaptor activity
GO:0019899	0.924	enzyme binding
GO:0042802	0.716	identical protein binding
GO:0051020	0.697	GTPase binding
GO:0031267	0.682	small GTPase binding
GO:0008093	0.649	cytoskeletal anchor activity
GO:0031625	0.648	ubiquitin protein ligase binding
GO:0070064	0.633	proline-rich region binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0050794	0.993	regulation of cellular process
GO:0071840	0.987	cellular component organization or biogenesis
GO:0048518	0.987	positive regulation of biological process
GO:0016043	0.984	cellular component organization
GO:0050896	0.976	response to stimulus
GO:0051128	0.961	regulation of cellular component organization
GO:0006996	0.915	organelle organization
GO:0031344	0.914	regulation of cell projection organization
GO:0048522	0.913	positive regulation of cellular process
GO:0120035	0.892	regulation of plasma membrane bounded cell projection organization
GO:0007010	0.847	cytoskeleton organization
GO:0023052	0.821	signaling
GO:0044085	0.753	cellular component biogenesis
GO:0051716	0.722	cellular response to stimulus
GO:0007154	0.679	cell communication
GO:0007165	0.655	signal transduction
GO:0034330	0.566	cell junction organization
GO:0051130	0.557	positive regulation of cellular component organization
GO:0032956	0.528	regulation of actin cytoskeleton organization
GO:0010638	0.524	positive regulation of organelle organization
GO:0044089	0.506	positive regulation of cellular component biogenesis
GO:1902903	0.504	regulation of supramolecular fiber organization
GO:0030029	0.470	actin filament-based process
GO:0019222	0.422	regulation of metabolic process
GO:0030036	0.406	actin cytoskeleton organization
GO:0031323	0.394	regulation of cellular metabolic process
GO:0060255	0.393	regulation of macromolecule metabolic process
GO:0071704	0.388	organic substance metabolic process
GO:0044238	0.387	primary metabolic process
GO:0032502	0.385	developmental process
GO:0120032	0.385	regulation of plasma membrane bounded cell projection assembly
GO:0080090	0.383	regulation of primary metabolic process
GO:0110053	0.383	regulation of actin filament organization
GO:0048856	0.381	anatomical structure development
GO:0051171	0.379	regulation of nitrogen compound metabolic process
GO:0035556	0.379	intracellular signal transduction
GO:0032501	0.377	multicellular organismal process
GO:0009893	0.375	positive regulation of metabolic process
GO:0051495	0.368	positive regulation of cytoskeleton organization
GO:0048519	0.365	negative regulation of biological process
GO:0048523	0.362	negative regulation of cellular process
GO:1902905	0.353	positive regulation of supramolecular fiber organization
GO:0120034	0.352	positive regulation of plasma membrane bounded cell projection assembly
GO:0048870	0.326	cell motility
GO:0022607	0.308	cellular component assembly

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0031981	0.996	nuclear lumen
GO:0005654	0.991	nucleoplasm
GO:0016020	0.463	membrane
GO:0120025	0.421	plasma membrane bounded cell projection
GO:0032991	0.370	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]