StarFunc result for job id Q9NYC9

User Input

>input (1400 residues)
MRLAEERAALAAENADGEPGADRRLRLLGTYVAMSLRPAAGAWERCAGSAEAEQLLQAFL
GRDAAEGPRPLLVVRPGPRGLAIRPGLEVGPESGLAGAKALFFLRTGPEPPGPDSFRGAV
VCGDLPAAPLEHLAALFSEVVLPVLANEKNRLNWPHMICEDVRRHAHSLQCDLSVILEQV
KGKTLLPLPAGSEKMEFADSKSETVLDSIDKSVIYAIESAVIKWSYQVQVVLKRESSQPL
LQGENPTPKVELEFWKSRYEDLKYIYNQLRTITVRGMAKLLDKLQSSYFPAFKAMYRDVV
AALAEAQDIHVHLIPLQRHLEALENAEFPEVKPQLRPLLHVVCLIWATCKSYRSPGRLTV
LLQEICNLLIQQASNYLSPEDLLRSEVEESQRKLQVVSDTLSFFKQEFQDRRENLHTYFK
ENQEVKEWDFQSSLVFVRLDGFLGQLHVVEGLLKTALDFHKLGKVEFSGVRGNALSQQVQ
QMHEEFQEMYRLLSGSSSDCLYLQSTDFENDVSEFNQKVEDLDRRLGTIFIQAFDDAPGL
EHAFKLLDIAGNLLERPLVARDTSDKYLVLIQMFNKDLDAVRMIYSQHVQEEAELGFSPV
HKNMPTVAGGLRWAQELRQRIQGPFSNFGRITHPCMESAEGKRMQQKYEDMLSLLEKYET
RLYEDWCRTVSEKSQYNLSQPLLKRDPETKEITINFNPQLISVLKEMSYLEPREMKHMPE
TAAAMFSSRDFYRQLVANLELMANWYNKVMKTLLEVEFPLVEEELQNIDLRLRAAEETLN
WKTEGICDYVTEITSSIHDLEQRIQKTKDNVEEIQNIMKTWVTPIFKTKDGKRESLLSLD
DRHDRMEKYYNLIKESGLKIHALVQENLGLFSADPTSNIWKTYVNSIDNLLLNGFFLAIE
CSLKYLLENTECKAGLTPIFEAQLSLAIPELVFYPSLESGVKGGFCDIVEGLITSIFRIP
SLVPRLSPQNGSPHYQVDLDGIPDLANMRRTLMERVQRMMGLCCGYQSTFSQYSYLYVED
RKEVLGQFLLYGHILTPEEIEDHVEDGIPENPPLLSQFKVQIDSYETLYEEVCRLEPIKV
FDGWMKIDIRPFKASLLNIIKRWSLLFKQHLVDHVTHSLANLDAFIKKSESGLLKKVEKG
DFQGLVEIMGHLMAVKERQSNTDEMFEPLKQTIELLKTYEQELPETVFKQLEELPEKWNN
IKKVAITVKQQVAPLQANEVTLLRQRCTAFDAEQQQFWEQFHKEAPFRFDSIHPHQMLDA
RHIEIQQMESTMASISESASLFEVNVPDYKQLRQCRKEVCQLKELWDTIGMVTSSIHAWE
TTPWRNINVEAMELECKQFARHIRNLDKEVRAWDAFTGLESTVWNTLSSLRAVAELQNPA
IRERHWRQLMQATGVSFTMD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0R4IUQ6	0.413	0.911	1.876E-45	614	0.189	0.430	A0A0R4IUQ6.pdb.gz
2	AFDB:Q5SX07	0.306	0.888	1.272E-44	457	0.250	0.766	Q5SX07.pdb.gz	Q5SX07_MOUSE Dynein, axonemal, heavy chain 9 OS=Mus musculus OX=10090 GN=Dnah9 PE=1 SV=1
3	PDB:7z8fe	0.327	0.120	2.887E-31	4579	0.153	0.047	7z8fe.pdb.gz	Structure of dynein-dynactin on microtubules shows tandem adaptor binding.
4	PDB:7kzmC	0.244	0.111	1.619E-16	3890	0.141	0.051	7kzmC.pdb.gz	Structure of a microtubule-bound axonemal dynein.
5	AFDB:Q8BXT7	0.126	0.769	2.220E-16	203	0.094	0.645	Q8BXT7.pdb.gz	Q8BXT7_MOUSE Uncharacterized protein OS=Mus musculus OX=10090 GN=Dnah9 PE=2 SV=1
6	PDB:7z8jf	0.259	0.455	3.270E-11	674	0.072	0.150	7z8jf.pdb.gz
7	AFDB:Q9VN30	0.225	0.284	1.371E-9	1079	0.064	0.082	Q9VN30.pdb.gz	Q9VN30_DROME Dynein heavy chain linker domain-containing protein OS=Drosophila melanogaster OX=7227 GN=sac PE=4 SV=3
8	AFDB:Q4FZC9	0.072	0.093	9.224E-5	975	0.092	0.132	Q4FZC9.pdb.gz	SYNE3_MOUSE Nesprin-3 OS=Mus musculus OX=10090 GN=Syne3 PE=1 SV=1
9	AFDB:Q6ZMZ3	0.074	0.095	3.536E-4	975	0.093	0.133	Q6ZMZ3.pdb.gz	SYNE3_HUMAN Nesprin-3 OS=Homo sapiens OX=9606 GN=SYNE3 PE=1 SV=2
10	AFDB:Q14AT2	0.064	0.078	4.514E-4	947	0.102	0.151	Q14AT2.pdb.gz	TEX11_MOUSE Testis-expressed protein 11 OS=Mus musculus OX=10090 GN=Tex11 PE=1 SV=1
11	AFDB:Q8TCG1	0.063	0.087	7.065E-4	905	0.102	0.158	Q8TCG1.pdb.gz	CIP2A_HUMAN Protein CIP2A OS=Homo sapiens OX=9606 GN=CIP2A PE=1 SV=2
12	AFDB:D6XEJ8	0.164	0.134	8.315E-4	1736	0.050	0.040	D6XEJ8.pdb.gz	D6XEJ8_TRYB2 Flagellar Member 4 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb04.1D20.10 PE=4 SV=1
13	AFDB:A0A087X256	0.062	0.072	9.020E-4	1174	0.100	0.119	A0A087X256.pdb.gz	A0A087X256_HUMAN WASH complex subunit 4 OS=Homo sapiens OX=9606 GN=WASHC4 PE=1 SV=1
14	PDB:8a2qB	0.090	0.103	1.975E-3	1084	0.097	0.125	8a2qB.pdb.gz
15	PDB:7qdrB	0.066	0.069	2.143E-3	1212	0.106	0.122	7qdrB.pdb.gz
16	PDB:7sukSP	0.070	0.058	2.849E-3	2234	0.111	0.069	7sukSP.pdb.gz	Artificial intelligence-assisted cryoEM structure of Bfr2-Lcp5 complex observed in the yeast small subunit processome.
17	PDB:1tr2B	0.067	0.083	3.091E-3	1029	0.086	0.118	1tr2B.pdb.gz
18	PDB:3gb8A	0.058	0.078	3.091E-3	958	0.089	0.129	3gb8A.pdb.gz
19	PDB:7mq8LM	0.096	0.074	3.220E-3	2005	0.130	0.091	7mq8LM.pdb.gz	Nucleolar maturation of the human small subunit processome.
20	PDB:6zwmB	0.074	0.058	3.947E-3	2185	0.116	0.075	6zwmB.pdb.gz	The 3.2- angstrom resolution structure of human mTORC2.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0B4KHJ4	0.0	988	4496	0.367	0.114	A0A0B4KHJ4_DROME Dynein heavy chain at 93AB, isoform C OS=Drosophila melanogaster OX=7227 GN=Dhc93AB PE=3 SV=1
2	B1AR51	0.0	2295	4484	0.782	0.244	B1AR51_MOUSE Dynein, axonemal, heavy chain 9 OS=Mus musculus OX=10090 GN=Dnah9 PE=1 SV=1
3	E9Q7N9	0.0	1123	4488	0.411	0.128	E9Q7N9_MOUSE Dynein, axonemal, heavy chain 11 OS=Mus musculus OX=10090 GN=Dnah11 PE=1 SV=2
4	F1SC07	0.0	1126	4518	0.403	0.125	DYH11_PIG Dynein axonemal heavy chain 11 OS=Sus scrofa OX=9823 GN=DNAH11 PE=1 SV=4
5	Q5SX07	0.0	733	457	0.250	0.766	Q5SX07_MOUSE Dynein, axonemal, heavy chain 9 OS=Mus musculus OX=10090 GN=Dnah9 PE=1 SV=1
6	Q69Z23	0.0	1147	4481	0.419	0.131	DYH17_MOUSE Dynein axonemal heavy chain 17 OS=Mus musculus OX=10090 GN=Dnah17 PE=1 SV=2
7	Q96DT5	0.0	1122	4516	0.410	0.127	DYH11_HUMAN Dynein axonemal heavy chain 11 OS=Homo sapiens OX=9606 GN=DNAH11 PE=1 SV=4
8	Q9NYC9	0.0	2902	4486	1.000	0.312	DYH9_HUMAN Dynein axonemal heavy chain 9 OS=Homo sapiens OX=9606 GN=DNAH9 PE=1 SV=3
9	Q9QZH1	0.0	1118	4488	0.411	0.128	Q9QZH1_MOUSE Left-right dynein OS=Mus musculus OX=10090 GN=Dnah11 PE=2 SV=1
10	Q9UFH2	0.0	1139	4462	0.406	0.127	DYH17_HUMAN Dynein axonemal heavy chain 17 OS=Homo sapiens OX=9606 GN=DNAH17 PE=1 SV=3
11	Q7SY17	1.33e-172	530	614	0.189	0.430	Q7SY17_DANRE Dynein, axonemal, heavy chain 9 OS=Danio rerio OX=7955 GN=Lrdr PE=1 SV=1
12	Q386I6	2.76e-106	377	4658	0.237	0.071	Q386I6_TRYB2 Dynein heavy chain, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.0760 PE=4 SV=1
13	Q8BXT7	4.74e-84	275	203	0.099	0.685	Q8BXT7_MOUSE Uncharacterized protein OS=Mus musculus OX=10090 GN=Dnah9 PE=2 SV=1
14	Q5LJN5	1.29e-78	290	4559	0.121	0.037	Q5LJN5_DROME Male fertility factor kl5 OS=Drosophila melanogaster OX=7227 GN=kl-5 PE=3 SV=4
15	Q9U3Y5	3.53e-78	289	4559	0.120	0.037	Q9U3Y5_DROME Dynein heavy chain OS=Drosophila melanogaster OX=7227 GN=kl-5 PE=2 SV=1
16	Q9MBF8	2.71e-76	283	4513	0.206	0.064	DYH1B_CHLRE Dynein-1-beta heavy chain, flagellar inner arm I1 complex OS=Chlamydomonas reinhardtii OX=3055 GN=DHC10 PE=1 SV=1
17	Q39575	2.73e-73	273	4485	0.201	0.063	DYHG_CHLRE Dynein gamma chain, flagellar outer arm OS=Chlamydomonas reinhardtii OX=3055 GN=ODA2 PE=1 SV=1
18	D3YYQ8	3.76e-58	224	4591	0.186	0.057	D3YYQ8_MOUSE Dynein, axonemal, heavy chain 10 OS=Mus musculus OX=10090 GN=Dnah10 PE=1 SV=2
19	Q57WX6	9.89e-53	207	4639	0.204	0.061	Q57WX6_TRYB2 Dynein heavy chain, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb03.27F10.490 PE=4 SV=1
20	Q9SMH3	7.93e-48	191	4625	0.184	0.056	DYH1A_CHLRE Dynein-1-alpha heavy chain, flagellar inner arm I1 complex OS=Chlamydomonas reinhardtii OX=3055 GN=DHC1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02553 CbiN	4.4e+02	12.3	Cobalt transport protein component CbiN
2	PF08654 DASH_Dad2	6e+02	12.3	DASH complex subunit Dad2
3	PF08651 DASH_Duo1	46	15.2	DASH complex subunit Duo1
4	PF08385 DHC_N1	1.3e-161	550.7	Dynein heavy chain, N-terminal region 1
5	PF08393 DHC_N2	1.7e-19	81.9	Dynein heavy chain, N-terminal region 2
6	PF07889 DUF1664	1.1e+02	14.2	Protein of unknown function (DUF1664)
7	PF12308 Noelin-1	2e+02	13.4	Neurogenesis glycoprotein
8	PF18363 PI_PP_I	3.9e+02	12.6	Phosphoinositide phosphatase insertion domain
9	PF17107 SesA	6.4	18.4	N-terminal domain on NACHT_NTPase and P-loop NTPases

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000262442

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000480538	0.900	Dynein intermediate chain 1, axonemal
2	9606.ENSP00000400252	0.885	Dynein intermediate chain 2, axonemal
3	9606.ENSP00000354791	0.879	Dynactin subunit 1
4	9606.ENSP00000408910	0.861	Dynactin subunit 2
5	9606.ENSP00000254286	0.820	Actin related protein 10 homolog
6	9606.ENSP00000289228	0.820	Beta-centractin
7	9606.ENSP00000358921	0.820	Alpha-centractin
8	9606.ENSP00000414906	0.807	Dynactin subunit 4
9	9606.ENSP00000334002	0.806	Huntingtin-associated protein 1
10	9606.ENSP00000259632	0.803	Dynactin subunit 3
11	9606.ENSP00000300087	0.801	Dynactin subunit 5
12	9606.ENSP00000221114	0.800	Dynactin subunit 6
13	9606.ENSP00000296218	0.792	Axonemal dynein light intermediate polypeptide 1
14	9606.ENSP00000318429	0.760	Coiled-coil domain-containing protein 114
15	9606.ENSP00000391869	0.760	annotation not available
16	9606.ENSP00000414390	0.757	Uncharacterized protein C11orf70
17	9606.ENSP00000288710	0.746	Dynein regulatory complex protein 1
18	9606.ENSP00000391692	0.738	Coiled-coil domain containing 103
19	9606.ENSP00000367815	0.717	Dynein assembly factor 1, axonemal
20	9606.ENSP00000216068	0.695	Dynein light chain 4, axonemal

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0007017	0.988	microtubule-based process
GO:0003341	0.951	cilium movement
GO:0032501	0.300	multicellular organismal process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005930	1.000	axoneme
GO:0097729	0.999	9+2 motile cilium
GO:0032991	0.945	protein-containing complex
GO:0015630	0.785	microtubule cytoskeleton
GO:1902494	0.753	catalytic complex
GO:0030286	0.723	dynein complex
GO:0005858	0.587	axonemal dynein complex
GO:0036157	0.374	outer dynein arm
GO:0120135	0.369	distal portion of axoneme

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]