StarFunc result for job id Q9NYF0

User Input

>input (836 residues)
MKPSPAGTAKELEPPAPARGEQRTAEPEGRWREKGEADTERQRTRERQEATLAGLAELEY
LRQRQELLVRGALRGAGGAGAAAPRAGELLGEAAQRSRLEEKFLEENILLLRKQLNCLRR
RDAGLLNQLQELDKQISDLRLDVEKTSEEHLETDSRPSSGFYELSDGASGSLSNSSNSVF
SECLSSCHSSTCFCSPLEATLSLSDGCPKSADLIGLLEYKEGHCEDQASGAVCRSLSTPQ
FNSLDVIADVNPKYQCDLVSKNGNDVYRYPSPLHAVAVQSPMFLLCLTGNPLREEDRLGN
HASDICGGSELDAVKTDSSLPSPSSLWSASHPSSSKKMDGYILSLVQKKTHPVRTNKPRT
SVNADPTKGLLRNGSVCVRAPGGVSQGNSVNLKNSKQACLPSGGIPSLNNGTFSPPKQWS
KESKAEQAESKRVPLPEGCPSGAASDLQSKHLPKTAKPASQEHARCSAIGTGESPKESAQ
LSGASPKESPSRGPAPPQENKVVQPLKKMSQKNSLQGVPPATPPLLSTAFPVEERPALDF
KSEGSSQSLEEAHLVKAQFIPGQQPSVRLHRGHRNMGVVKNSSLKHRGPALQGLENGLPT
VREKTRAGSKKCRFPDDLDTNKKLKKASSKGRKSGGGPEAGVPGRPAGGGHRAGSRAHGH
GREAVVAKPKHKRTDYRRWKSSAEISYEEALRRARRGRRENVGLYPAPVPLPYASPYAYV
ASDSEYSAECESLFHSTVVDTSEDEQSNYTTNCFGDSESSVSEGEFVGESTTTSDSEESG
GLIWSQFVQTLPIQTVTAPDLHNHPAKTFVKIKASHNLKKKILRFRSGSLKLMTTV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9NYF0	1.000	1.000	0.000	836	1.000	1.000	Q9NYF0.pdb.gz	DACT1_HUMAN Dapper homolog 1 OS=Homo sapiens OX=9606 GN=DACT1 PE=1 SV=2
2	AFDB:Q8R4A3	0.219	0.231	2.477E-75	778	0.772	0.829	Q8R4A3.pdb.gz	DACT1_MOUSE Dapper homolog 1 OS=Mus musculus OX=10090 GN=Dact1 PE=1 SV=1
3	AFDB:Q8QG92	0.196	0.198	4.835E-55	824	0.623	0.632	Q8QG92.pdb.gz	DCT1B_XENLA Dapper 1-B OS=Xenopus laevis OX=8355 GN=dact1-b PE=1 SV=1
4	AFDB:Q6QZN6	0.151	0.153	8.854E-41	821	0.467	0.475	Q6QZN6.pdb.gz	DACT1_DANRE Dapper homolog 1 OS=Danio rerio OX=7955 GN=dact1 PE=1 SV=1
5	AFDB:Q673G8	0.092	0.092	3.858E-18	837	0.304	0.303	Q673G8.pdb.gz	DACT2_DANRE Dapper homolog 2 OS=Danio rerio OX=7955 GN=dact2 PE=1 SV=2
6	AFDB:Q7TN08	0.084	0.090	3.941E-16	757	0.268	0.296	Q7TN08.pdb.gz	DACT2_MOUSE Dapper homolog 2 OS=Mus musculus OX=10090 GN=Dact2 PE=1 SV=2
7	AFDB:I6L8A6	0.068	0.063	4.881E-2	902	0.159	0.147	I6L8A6.pdb.gz	I6L8A6_HUMAN DNA endonuclease RBBP8 OS=Homo sapiens OX=9606 GN=RBBP8 PE=1 SV=1
8	AFDB:Q8NC74	0.070	0.087	5.210E-2	664	0.132	0.166	Q8NC74.pdb.gz	RB8NL_HUMAN RBBP8 N-terminal-like protein OS=Homo sapiens OX=9606 GN=RBBP8NL PE=1 SV=3
9	AFDB:B1WC58	0.071	0.067	5.560E-2	893	0.167	0.157	B1WC58.pdb.gz	CTIP_RAT DNA endonuclease RBBP8 OS=Rattus norvegicus OX=10116 GN=Rbbp8 PE=2 SV=1
10	AFDB:Q32MZ4	0.066	0.068	8.774E-2	808	0.140	0.145	Q32MZ4.pdb.gz	LRRF1_HUMAN Leucine-rich repeat flightless-interacting protein 1 OS=Homo sapiens OX=9606 GN=LRRFIP1 PE=1 SV=2
11	PDB:6nmiC	0.029	0.047	4.643	408	0.024	0.049	6nmiC.pdb.gz	The complete structure of the human TFIIH core complex.
12	PDB:6wucK	0.059	0.194	6.025	235	0.017	0.060	6wucK.pdb.gz
13	PDB:7pntU	0.064	0.291	9.507	174	0.035	0.167	7pntU.pdb.gz	Mechanism of mitoribosomal small subunit biogenesis and preinitiation.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B7Z673	0.0	1134	555	0.664	1.000	B7Z673_HUMAN Dishevelled binding antagonist of beta catenin 1 OS=Homo sapiens OX=9606 GN=DACT1 PE=1 SV=1
2	Q6QZN6	0.0	583	821	0.484	0.493	DACT1_DANRE Dapper homolog 1 OS=Danio rerio OX=7955 GN=dact1 PE=1 SV=1
3	Q8JJ48	0.0	834	818	0.597	0.610	DCT1A_XENLA Dapper 1-A OS=Xenopus laevis OX=8355 GN=dact1-a PE=1 SV=1
4	Q8QG92	0.0	886	824	0.623	0.632	DCT1B_XENLA Dapper 1-B OS=Xenopus laevis OX=8355 GN=dact1-b PE=1 SV=1
5	Q8R4A3	0.0	1176	778	0.773	0.830	DACT1_MOUSE Dapper homolog 1 OS=Mus musculus OX=10090 GN=Dact1 PE=1 SV=1
6	Q9NYF0	0.0	1703	836	1.000	1.000	DACT1_HUMAN Dapper homolog 1 OS=Homo sapiens OX=9606 GN=DACT1 PE=1 SV=2
7	Q673G8	9.05e-39	157	837	0.146	0.146	DACT2_DANRE Dapper homolog 2 OS=Danio rerio OX=7955 GN=dact2 PE=1 SV=2
8	Q7TN08	8.56e-37	150	757	0.139	0.153	DACT2_MOUSE Dapper homolog 2 OS=Mus musculus OX=10090 GN=Dact2 PE=1 SV=2
9	Q5SW24	3.53e-28	124	774	0.124	0.134	DACT2_HUMAN Dapper homolog 2 OS=Homo sapiens OX=9606 GN=DACT2 PE=1 SV=1
10	Q96B18	4.11e-08	59.3	629	0.032	0.043	DACT3_HUMAN Dapper homolog 3 OS=Homo sapiens OX=9606 GN=DACT3 PE=1 SV=2
11	Q0PHV7	5.27e-08	58.9	610	0.032	0.044	DACT3_MOUSE Dapper homolog 3 OS=Mus musculus OX=10090 GN=Dact3 PE=1 SV=1
12	G5E9H6	0.043	38.5	181	0.024	0.110	G5E9H6_HUMAN Dishevelled binding antagonist of beta catenin 3 OS=Homo sapiens OX=9606 GN=DACT3 PE=1 SV=1
13	Q8CCN1	4.9	33.1	673	0.018	0.022	NAL10_MOUSE NACHT, LRR and PYD domains-containing protein 10 OS=Mus musculus OX=10090 GN=Nlrp10 PE=1 SV=1
14	Q9UPN4	5.3	33.1	1083	0.072	0.055	CP131_HUMAN Centrosomal protein of 131 kDa OS=Homo sapiens OX=9606 GN=CEP131 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15268 Dapper	2.8e-264	891.6	Dapper
2	PF15039 DUF4530	29	16.2	Domain of unknown function (DUF4530)
3	PF14854 LURAP	7.2	18.0	Leucine rich adaptor protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000337439

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000005340	0.991	Segment polarity protein dishevelled homolog DVL-2
2	9606.ENSP00000368169	0.987	Segment polarity protein dishevelled homolog DVL-1
3	9606.ENSP00000357040	0.841	Vang-like protein 2
4	9606.ENSP00000347672	0.802	VANGL planar cell polarity protein 1
5	9606.ENSP00000362649	0.726	Histone deacetylase 1
6	9606.ENSP00000344242	0.672	Leucine-rich repeat-containing protein 17
7	9606.ENSP00000418754	0.644	Inactive tyrosine-protein kinase 7
8	9606.ENSP00000418668	0.642	Caveolae-associated protein 4
9	9606.ENSP00000415332	0.639	SEC14 domain and spectrin repeat-containing protein 1
10	9606.ENSP00000361636	0.626	Troponin C, skeletal muscle
11	9606.ENSP00000255416	0.625	Myosin-binding protein H
12	9606.ENSP00000355245	0.623	Paired box protein Pax-9
13	9606.ENSP00000344456	0.619	Catenin beta-1
14	9606.ENSP00000316054	0.616	Segment polarity protein dishevelled homolog DVL-3
15	9606.ENSP00000229239	0.603	Glyceraldehyde-3-phosphate dehydrogenase
16	9606.ENSP00000364885	0.589	Zinc finger and BTB domain-containing protein 17
17	9606.ENSP00000361930	0.578	14-3-3 protein beta/alpha
18	9606.ENSP00000481103	0.577	Transcription factor E2F8
19	9606.ENSP00000352608	0.575	Ryanodine receptor 1
20	9606.ENSP00000349960	0.573	Actin, cytoplasmic 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0051018	1.000	protein kinase A binding
GO:0019899	1.000	enzyme binding
GO:0008134	0.989	transcription factor binding
GO:0008013	0.951	beta-catenin binding
GO:0140297	0.918	DNA-binding transcription factor binding
GO:0042826	0.915	histone deacetylase binding
GO:0061629	0.886	RNA polymerase II-specific DNA-binding transcription factor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.996	regulation of cellular process
GO:0048523	0.983	negative regulation of cellular process
GO:0048583	0.975	regulation of response to stimulus
GO:0009966	0.971	regulation of signal transduction
GO:0019222	0.946	regulation of metabolic process
GO:0048518	0.940	positive regulation of biological process
GO:0060255	0.937	regulation of macromolecule metabolic process
GO:0048585	0.935	negative regulation of response to stimulus
GO:0031323	0.931	regulation of cellular metabolic process
GO:0048522	0.925	positive regulation of cellular process
GO:0030111	0.915	regulation of Wnt signaling pathway
GO:0051171	0.914	regulation of nitrogen compound metabolic process
GO:0090090	0.913	negative regulation of canonical Wnt signaling pathway
GO:0009987	0.909	cellular process
GO:1902531	0.892	regulation of intracellular signal transduction
GO:0080134	0.879	regulation of response to stress
GO:0080090	0.872	regulation of primary metabolic process
GO:0080135	0.872	regulation of cellular response to stress
GO:0070302	0.862	regulation of stress-activated protein kinase signaling cascade
GO:0032501	0.855	multicellular organismal process
GO:0048856	0.852	anatomical structure development
GO:0019219	0.818	regulation of nucleobase-containing compound metabolic process
GO:0046328	0.818	regulation of JNK cascade
GO:0010468	0.812	regulation of gene expression
GO:0010556	0.807	regulation of macromolecule biosynthetic process
GO:0031326	0.806	regulation of cellular biosynthetic process
GO:0070303	0.801	negative regulation of stress-activated protein kinase signaling cascade
GO:0010605	0.798	negative regulation of macromolecule metabolic process
GO:0051172	0.795	negative regulation of nitrogen compound metabolic process
GO:0031324	0.795	negative regulation of cellular metabolic process
GO:2001141	0.786	regulation of RNA biosynthetic process
GO:0006355	0.784	regulation of DNA-templated transcription
GO:0032873	0.773	negative regulation of stress-activated MAPK cascade
GO:0046329	0.744	negative regulation of JNK cascade
GO:0007275	0.690	multicellular organism development
GO:0010558	0.619	negative regulation of macromolecule biosynthetic process
GO:0031327	0.618	negative regulation of cellular biosynthetic process
GO:0009893	0.612	positive regulation of metabolic process
GO:0010604	0.604	positive regulation of macromolecule metabolic process
GO:0048731	0.587	system development
GO:0051173	0.581	positive regulation of nitrogen compound metabolic process
GO:0006357	0.554	regulation of transcription by RNA polymerase II
GO:0050896	0.510	response to stimulus
GO:0051246	0.491	regulation of protein metabolic process
GO:0071840	0.439	cellular component organization or biogenesis
GO:0016043	0.406	cellular component organization
GO:0065009	0.381	regulation of molecular function
GO:0051128	0.370	regulation of cellular component organization
GO:0051716	0.364	cellular response to stimulus
GO:0051253	0.361	negative regulation of RNA metabolic process
GO:0045892	0.338	negative regulation of DNA-templated transcription
GO:0007154	0.311	cell communication

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.995	nucleoplasm
GO:0005829	0.993	cytosol
GO:0032991	0.983	protein-containing complex
GO:1902494	0.899	catalytic complex
GO:0140535	0.723	intracellular protein-containing complex
GO:0030877	0.586	beta-catenin destruction complex
GO:0016020	0.543	membrane
GO:0043232	0.399	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]