StarFunc result for job id Q9NYF8

User Input

>input (920 residues)
MGRSNSRSHSSRSKSRSQSSSRSRSRSHSRKKRYSSRSRSRTYSRSRSRDRMYSRDYRRD
YRNNRGMRRPYGYRGRGRGYYQGGGGRYHRGGYRPVWNRRHSRSPRRGRSRSRSPKRRSV
SSQRSRSRSRRSYRSSRSPRSSSSRSSSPYSKSPVSKRRGSQEKQTKKAEGEPQEESPLK
SKSQEEPKDTFEHDPSESIDEFNKSSATSGDIWPGLSAYDNSPRSPHSPSPIATPPSQSS
SCSDAPMLSTVHSAKNTPSQHSHSIQHSPERSGSGSVGNGSSRYSPSQNSPIHHIPSRRS
PAKTIAPQNAPRDESRGRSSFYPDGGDQETAKTGKFLKRFTDEESRVFLLDRGNTRDKEA
SKEKGSEKGRAEGEWEDQEALDYFSDKESGKQKFNDSEGDDTEETEDYRQFRKSVLADQG
KSFATASHRNTEEEGLKYKSKVSLKGNRESDGFREEKNYKLKETGYVVERPSTTKDKHKE
EDKNSERITVKKETQSPEQVKSEKLKDLFDYSPPLHKNLDAREKSTFREESPLRIKMIAS
DSHRPEVKLKMAPVPLDDSNRPASLTKDRLLASTLVHSVKKEQEFRSIFDHIKLPQASKS
TSESFIQHIVSLVHHVKEQYFKSAAMTLNERFTSYQKATEEHSTRQKSPEIHRRIDISPS
TLRKHTRLAGEERVFKEENQKGDKKLRCDSADLRHDIDRRRKERSKERGDSKGSRESSGS
RKQEKTPKDYKEYKSYKDDSKHKREQDHSRSSSSSASPSSPSSREEKESKKEREEEFKTH
HEMKEYSGFAGVSRPRGTFFRIRGRGRARGVFAGTNTGPNNSNTTFQKRPKEEEWDPEYT
PKSKKYFLHDDRDDGVDYWAKRGRGRGTFQRGRGRFNFKKSGSSPKWTHDKYQGDGIVED
EEETMENNEEKKDRRKEEKE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9NYF8	1.000	1.000	0.000	920	1.000	1.000	Q9NYF8.pdb.gz	BCLF1_HUMAN Bcl-2-associated transcription factor 1 OS=Homo sapiens OX=9606 GN=BCLAF1 PE=1 SV=2
2	AFDB:Q9Y2W1	0.097	0.095	1.006E-35	955	0.402	0.387	Q9Y2W1.pdb.gz	TR150_HUMAN Thyroid hormone receptor-associated protein 3 OS=Homo sapiens OX=9606 GN=THRAP3 PE=1 SV=2
3	AFDB:Q60988	0.042	0.033	1.491E-5	1262	0.129	0.094	Q60988.pdb.gz	STIL_MOUSE SCL-interrupting locus protein homolog OS=Mus musculus OX=10090 GN=Stil PE=1 SV=1
4	AFDB:Q9C0I3	0.052	0.053	1.700E-5	900	0.146	0.149	Q9C0I3.pdb.gz	CCSE1_HUMAN Serine-rich coiled-coil domain-containing protein 1 OS=Homo sapiens OX=9606 GN=CCSER1 PE=1 SV=2
5	AFDB:Q8IHQ2	0.047	0.037	3.742E-5	1301	0.107	0.075	Q8IHQ2.pdb.gz	Q8IHQ2_PLAF7 Oocyst rupture protein 1, putative OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1146600 PE=3 SV=1
6	AFDB:Q86PA6	0.038	0.046	1.071E-4	744	0.112	0.138	Q86PA6.pdb.gz	Q86PA6_DROME LD29371p OS=Drosophila melanogaster OX=7227 GN=da PE=1 SV=1
7	AFDB:J9VE33	0.046	0.035	3.496E-4	1094	0.143	0.121	J9VE33.pdb.gz	CRZ1_CRYNH Transcriptional regulator CRZ1 OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) OX=235443 GN=CRZ1 PE=1 SV=1
8	AFDB:O35413	0.052	0.045	3.733E-4	1196	0.139	0.107	O35413.pdb.gz	SRBS2_RAT Sorbin and SH3 domain-containing protein 2 OS=Rattus norvegicus OX=10116 GN=Sorbs2 PE=1 SV=2
9	AFDB:Q8IRB5	0.043	0.029	3.733E-4	1465	0.108	0.068	Q8IRB5.pdb.gz	CLSPN_DROME Claspin OS=Drosophila melanogaster OX=7227 GN=Claspin PE=1 SV=1
10	AFDB:M9PB92	0.047	0.042	4.547E-4	1062	0.109	0.094	M9PB92.pdb.gz	M9PB92_DROME CCR4-NOT transcription complex subunit 4, isoform K OS=Drosophila melanogaster OX=7227 GN=Cnot4 PE=1 SV=1
11	PDB:6zxdz	0.027	0.079	2.336	292	0.024	0.075	6zxdz.pdb.gz	Structural basis for the final steps of human 40S ribosome maturation.
12	PDB:7aavv	0.041	0.113	4.220	206	0.023	0.102	7aavv.pdb.gz	Mechanism of protein-guided folding of the active site U2/U6 RNA during spliceosome activation.
13	PDB:7kpxC	0.045	0.034	4.220	1352	0.013	0.009	7kpxC.pdb.gz
14	PDB:6qlfQ	0.053	0.158	4.507	204	0.023	0.103	6qlfQ.pdb.gz
15	PDB:7ungi	0.056	0.136	4.507	250	0.030	0.112	7ungi.pdb.gz	SPACA9 is a lumenal protein of human ciliary singlet and doublet microtubules.
16	PDB:7ajtCL	0.042	0.048	4.813	781	0.020	0.023	7ajtCL.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
17	PDB:5ganG	0.038	0.084	6.261	318	0.018	0.053	5ganG.pdb.gz	Cryo-EM structure of the yeast U4/U6.U5 tri-snRNP at 3.7 angstrom resolution.
18	PDB:6wotA	0.027	0.007	6.261	4197	0.014	0.003	6wotA.pdb.gz	Structural mechanism of two gain-of-function cardiac and skeletal RyR mutations at an equivalent site by cryo-EM.
19	PDB:7d63RJ	0.043	0.048	6.686	796	0.020	0.023	7d63RJ.pdb.gz	Cryo-EM structure of 90S preribosome with inactive Utp24 (state C)
20	PDB:7z1lQ	0.030	0.142	6.686	123	0.022	0.163	7z1lQ.pdb.gz	Architecture of the yeast Pol III pre-termination complex and pausing mechanism on poly(dT) termination signals.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	E9PK09	0.0	1443	725	0.788	1.000	E9PK09_HUMAN BCL2 associated transcription factor 1 (Fragment) OS=Homo sapiens OX=9606 GN=BCLAF1 PE=1 SV=8
2	E9PK91	0.0	1664	871	0.930	0.983	E9PK91_HUMAN BCL2 associated transcription factor 1 OS=Homo sapiens OX=9606 GN=BCLAF1 PE=1 SV=1
3	E9PKI6	0.0	1475	752	0.805	0.985	E9PKI6_HUMAN BCL2 associated transcription factor 1 OS=Homo sapiens OX=9606 GN=BCLAF1 PE=1 SV=1
4	Q8K019	0.0	1328	919	0.903	0.904	BCLF1_MOUSE Bcl-2-associated transcription factor 1 OS=Mus musculus OX=10090 GN=Bclaf1 PE=1 SV=2
5	Q9NYF8	0.0	1842	920	1.000	1.000	BCLF1_HUMAN Bcl-2-associated transcription factor 1 OS=Homo sapiens OX=9606 GN=BCLAF1 PE=1 SV=2
6	Q9Y2W1	1.63e-67	245	955	0.214	0.206	TR150_HUMAN Thyroid hormone receptor-associated protein 3 OS=Homo sapiens OX=9606 GN=THRAP3 PE=1 SV=2
7	Q569Z6	9.87e-66	240	951	0.197	0.190	TR150_MOUSE Thyroid hormone receptor-associated protein 3 OS=Mus musculus OX=10090 GN=Thrap3 PE=1 SV=1
8	A0A3B3ITZ9	5.56e-51	196	910	0.184	0.186	A0A3B3ITZ9_HUMAN Thyroid hormone receptor associated protein 3 OS=Homo sapiens OX=9606 GN=THRAP3 PE=1 SV=1
9	A0A8I6AP88	3.2	33.9	1129	0.042	0.035	A0A8I6AP88_RAT Tight junction protein 2 OS=Rattus norvegicus OX=10116 GN=Tjp2 PE=1 SV=1
10	Q3ZB99	4.3	33.5	1164	0.042	0.034	Q3ZB99_RAT Tight junction protein 2 OS=Rattus norvegicus OX=10116 GN=Tjp2 PE=1 SV=1
11	A0A8J8Y4W9	4.5	33.5	1166	0.042	0.033	A0A8J8Y4W9_RAT Tight junction protein 2 OS=Rattus norvegicus OX=10116 GN=Tjp2 PE=1 SV=1
12	A0A8I6GLX8	5.5	33.1	1189	0.042	0.033	A0A8I6GLX8_RAT Tight junction protein 2 OS=Rattus norvegicus OX=10116 GN=Tjp2 PE=4 SV=1
13	A0A8I6ALD4	6.1	33.1	1239	0.042	0.031	A0A8I6ALD4_RAT Tight junction protein 2 OS=Rattus norvegicus OX=10116 GN=Tjp2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15440 THRAP3_BCLAF1	1.1e-151	518.9	THRAP3/BCLAF1 family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000435210

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000358857	0.985	Emerin
2	9606.ENSP00000418960	0.973	Breast cancer type 1 susceptibility protein
3	9606.ENSP00000346634	0.950	Thyroid hormone receptor-associated protein 3
4	9606.ENSP00000296215	0.843	Smad nuclear-interacting protein 1
5	9606.ENSP00000434024	0.823	Histone H2AX
6	9606.ENSP00000216832	0.816	Pinin
7	9606.ENSP00000431962	0.812	Lethal(3)malignant brain tumor-like protein 3
8	9606.ENSP00000307863	0.784	Splicing factor U2AF 65 kDa subunit
9	9606.ENSP00000354346	0.771	Matrin-3
10	9606.ENSP00000357679	0.770	Chromatin target of PRMT1 protein
11	9606.ENSP00000293362	0.747	Proteasome activator complex subunit 3
12	9606.ENSP00000421592	0.739	THO complex subunit 4
13	9606.ENSP00000379475	0.738	Spliceosome RNA helicase DDX39B
14	9606.ENSP00000357345	0.731	Dual specificity protein kinase CLK2
15	9606.ENSP00000451080	0.715	Enhancer of rudimentary homolog
16	9606.ENSP00000261531	0.714	SNW domain-containing protein 1
17	9606.ENSP00000353224	0.701	Transferrin receptor protein 1
18	9606.ENSP00000347005	0.698	Putative RNA-binding protein Luc7-like 2
19	9606.ENSP00000369895	0.686	Gem-associated protein 8
20	9606.ENSP00000265097	0.684	THO complex subunit 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0003723	0.999	RNA binding
GO:0003677	0.999	DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.986	cellular process
GO:0050789	0.985	regulation of biological process
GO:0050794	0.982	regulation of cellular process
GO:0080090	0.978	regulation of primary metabolic process
GO:0060255	0.977	regulation of macromolecule metabolic process
GO:0051171	0.973	regulation of nitrogen compound metabolic process
GO:0031323	0.973	regulation of cellular metabolic process
GO:0010468	0.973	regulation of gene expression
GO:0048519	0.969	negative regulation of biological process
GO:0050896	0.966	response to stimulus
GO:0051252	0.949	regulation of RNA metabolic process
GO:0048518	0.947	positive regulation of biological process
GO:0051716	0.934	cellular response to stimulus
GO:0048522	0.923	positive regulation of cellular process
GO:0009892	0.910	negative regulation of metabolic process
GO:0009889	0.907	regulation of biosynthetic process
GO:0048523	0.897	negative regulation of cellular process
GO:0010556	0.897	regulation of macromolecule biosynthetic process
GO:0031326	0.897	regulation of cellular biosynthetic process
GO:0010604	0.891	positive regulation of macromolecule metabolic process
GO:0051173	0.883	positive regulation of nitrogen compound metabolic process
GO:0031325	0.883	positive regulation of cellular metabolic process
GO:0006355	0.878	regulation of DNA-templated transcription
GO:0071704	0.869	organic substance metabolic process
GO:0043170	0.811	macromolecule metabolic process
GO:0045935	0.782	positive regulation of nucleobase-containing compound metabolic process
GO:0010605	0.777	negative regulation of macromolecule metabolic process
GO:0009891	0.767	positive regulation of biosynthetic process
GO:0031328	0.763	positive regulation of cellular biosynthetic process
GO:0044238	0.752	primary metabolic process
GO:0006807	0.749	nitrogen compound metabolic process
GO:0051254	0.748	positive regulation of RNA metabolic process
GO:0010557	0.744	positive regulation of macromolecule biosynthetic process
GO:0044237	0.705	cellular metabolic process
GO:0051172	0.679	negative regulation of nitrogen compound metabolic process
GO:0031324	0.679	negative regulation of cellular metabolic process
GO:0042221	0.673	response to chemical
GO:0045893	0.671	positive regulation of DNA-templated transcription
GO:0048583	0.596	regulation of response to stimulus
GO:0034097	0.589	response to cytokine
GO:0046483	0.495	heterocycle metabolic process
GO:0034641	0.490	cellular nitrogen compound metabolic process
GO:0006725	0.487	cellular aromatic compound metabolic process
GO:0090304	0.476	nucleic acid metabolic process
GO:0045934	0.460	negative regulation of nucleobase-containing compound metabolic process
GO:1990823	0.441	response to leukemia inhibitory factor
GO:0051253	0.435	negative regulation of RNA metabolic process
GO:0016070	0.410	RNA metabolic process
GO:0010467	0.344	gene expression
GO:0009966	0.324	regulation of signal transduction
GO:0006950	0.321	response to stress
GO:0042981	0.311	regulation of apoptotic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016607	1.000	nuclear speck
GO:0032991	0.947	protein-containing complex
GO:0005737	0.552	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]