StarFunc result for job id Q9NYH9

User Input

>input (597 residues)
MAEIIQERIEDRLPELEQLERIGLFSHAEIKAIIKKASDLEYKIQRRTLFKEDFINYVQY
EINLLELIQRRRTRIGYSFKKDEIENSIVHRVQGVFQRASAKWKDDVQLWLSYVAFCKKW
ATKTRLSKVFSAMLAIHSNKPALWIMAAKWEMEDRLSSESARQLFLRALRFHPECPKLYK
EYFRMELMHAEKLRKEKEEFEKASMDVENPDYSEEILKGELAWIIYKNSVSIIKGAEFHV
SLLSIAQLFDFAKDLQKEIYDDLQALHTDDPLTWDYVARRELEIESQTEEQPTTKQAKAV
EVGRKEERCCAVYEEAVKTLPTEAMWKCYITFCLERFTKKSNSGFLRGKRLERTMTVFRK
AHELKLLSECQYKQLSVSLLCYNFLREALEVAVAGTELFRDSGTMWQLKLQVLIESKSPD
IAMLFEEAFVHLKPQVCLPLWISWAEWSEGAKSQEDTEAVFKKALLAVIGADSVTLKNKY
LDWAYRSGGYKKARAVFKSLQESRPFSVDFFRKMIQFEKEQESCNMANIREYYERALREF
GSADSDLWMDYMKEELNHPLGRPENCGQIYWRAMKMLQGESAEAFVAKHAMHQTGHL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9NYH9	1.000	1.000	3.805E-72	597	1.000	1.000	Q9NYH9.pdb.gz	UTP6_HUMAN U3 small nucleolar RNA-associated protein 6 homolog OS=Homo sapiens OX=9606 GN=UTP6 PE=1 SV=2
2	PDB:7mq8LP	0.801	0.840	6.411E-58	567	0.946	0.996	7mq8LP.pdb.gz	Nucleolar maturation of the human small subunit processome.
3	AFDB:O60188	0.322	0.391	1.254E-11	488	0.174	0.213	O60188.pdb.gz	UTP6_SCHPO U3 small nucleolar RNA-associated protein 6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=utp6 PE=3 SV=1
4	AFDB:A0A1D8PF14	0.316	0.429	9.917E-11	431	0.157	0.218	A0A1D8PF14.pdb.gz	A0A1D8PF14_CANAL SnoRNA-binding rRNA-processing protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CAALFM_C110880WA PE=3 SV=1
5	AFDB:Q02354	0.307	0.411	1.852E-10	440	0.154	0.209	Q02354.pdb.gz	UTP6_YEAST U3 small nucleolar RNA-associated protein 6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=UTP6 PE=1 SV=2
6	AFDB:Q9ZT71	0.282	0.186	2.432E-9	1029	0.164	0.095	Q9ZT71.pdb.gz	STA1_ARATH Protein STABILIZED1 OS=Arabidopsis thaliana OX=3702 GN=STA1 PE=1 SV=1
7	AFDB:Q9VVU6	0.276	0.202	2.957E-9	931	0.144	0.092	Q9VVU6.pdb.gz	Q9VVU6_DROME Pre-mRNA-processing factor 6 OS=Drosophila melanogaster OX=7227 GN=Prp6 PE=1 SV=2
8	AFDB:P17886	0.356	0.309	4.040E-9	702	0.168	0.142	P17886.pdb.gz	CRN_DROME Protein crooked neck OS=Drosophila melanogaster OX=7227 GN=crn PE=2 SV=2
9	AFDB:Q9P7R9	0.291	0.229	4.910E-9	790	0.183	0.138	Q9P7R9.pdb.gz	SYF1_SCHPO Pre-mRNA-splicing factor cwf3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=cwf3 PE=1 SV=1
10	AFDB:F4JZX8	0.342	0.296	7.843E-9	705	0.173	0.146	F4JZX8.pdb.gz	F4JZX8_ARATH Crooked neck protein, putative / cell cycle protein OS=Arabidopsis thaliana OX=3702 GN=At5g41770 PE=1 SV=1
11	AFDB:P87312	0.364	0.328	1.159E-8	674	0.169	0.150	P87312.pdb.gz	CLF1_SCHPO Pre-mRNA-splicing factor cwf4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=cwf4 PE=1 SV=1
12	PDB:7d4iB6	0.397	0.587	5.621E-8	377	0.131	0.207	7d4iB6.pdb.gz	Cryo-EM structure of 90S small ribosomal precursors complex with Dhr1
13	PDB:7qdrB	0.207	0.120	6.833E-8	1212	0.136	0.067	7qdrB.pdb.gz
14	PDB:4bujB	0.229	0.115	2.895E-7	1367	0.122	0.053	4bujB.pdb.gz
15	PDB:7ntfA	0.234	0.167	1.226E-6	918	0.097	0.063	7ntfA.pdb.gz
16	PDB:6uroE	0.274	0.305	1.676E-6	527	0.134	0.152	6uroE.pdb.gz	Structural Insights into the Human Pre-mRNA 3'-End Processing Machinery.
17	PDB:7dkhI	0.195	0.141	1.676E-6	914	0.132	0.086	7dkhI.pdb.gz
18	PDB:6bq1B	0.203	0.172	1.812E-6	728	0.107	0.088	6bq1B.pdb.gz	Architecture of the human PI4KIII alpha lipid kinase complex.
19	PDB:5nrlJ	0.279	0.224	2.574E-6	800	0.149	0.111	5nrlJ.pdb.gz	Structure of a pre-catalytic spliceosome.
20	PDB:6bk8T	0.307	0.364	3.657E-6	483	0.136	0.168	6bk8T.pdb.gz	Structure of the yeast spliceosomal postcatalytic P complex.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9NYH9	0.0	1231	597	1.000	1.000	UTP6_HUMAN U3 small nucleolar RNA-associated protein 6 homolog OS=Homo sapiens OX=9606 GN=UTP6 PE=1 SV=2
2	O60188	4.63e-27	117	488	0.117	0.143	UTP6_SCHPO U3 small nucleolar RNA-associated protein 6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=utp6 PE=3 SV=1
3	Q02354	5.02e-26	113	440	0.101	0.136	UTP6_YEAST U3 small nucleolar RNA-associated protein 6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=UTP6 PE=1 SV=2
4	A0A1D8PF14	2.05e-24	108	431	0.119	0.165	A0A1D8PF14_CANAL SnoRNA-binding rRNA-processing protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CAALFM_C110880WA PE=3 SV=1
5	Q38CX5	3.31e-05	49.3	897	0.079	0.052	Q38CX5_TRYB2 U3 small nucleolar RNA-associated protein 6 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.244.2650 PE=4 SV=1
6	Q9FNM3	0.023	40.0	673	0.149	0.132	Q9FNM3_ARATH CRN (Crooked neck) protein OS=Arabidopsis thaliana OX=3702 GN=MCL19.3 PE=1 SV=1
7	Q54XP4	0.032	39.7	705	0.089	0.075	CRNL1_DICDI Crooked neck-like protein 1 OS=Dictyostelium discoideum OX=44689 GN=crnkl1 PE=3 SV=1
8	P17886	0.037	39.7	702	0.179	0.152	CRN_DROME Protein crooked neck OS=Drosophila melanogaster OX=7227 GN=crn PE=2 SV=2
9	P87312	0.077	38.5	674	0.146	0.129	CLF1_SCHPO Pre-mRNA-splicing factor cwf4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=cwf4 PE=1 SV=1
10	F4JZX8	0.34	36.2	705	0.037	0.031	F4JZX8_ARATH Crooked neck protein, putative / cell cycle protein OS=Arabidopsis thaliana OX=3702 GN=At5g41770 PE=1 SV=1
11	P63155	0.40	36.2	690	0.203	0.175	CRNL1_RAT Crooked neck-like protein 1 OS=Rattus norvegicus OX=10116 GN=Crnkl1 PE=2 SV=1
12	A0JPN7	0.42	36.2	590	0.050	0.051	A0JPN7_RAT Cleavage stimulation factor, 3' pre-RNA, subunit 3 OS=Rattus norvegicus OX=10116 GN=Cstf3 PE=2 SV=1
13	Q9BZJ0	0.47	35.8	848	0.184	0.130	CRNL1_HUMAN Crooked neck-like protein 1 OS=Homo sapiens OX=9606 GN=CRNKL1 PE=1 SV=4
14	A0A096MJQ0	0.53	35.8	567	0.050	0.053	A0A096MJQ0_RAT Cleavage stimulation factor subunit 3 OS=Rattus norvegicus OX=10116 GN=Cstf3 PE=1 SV=2
15	Q12996	0.73	35.4	717	0.050	0.042	CSTF3_HUMAN Cleavage stimulation factor subunit 3 OS=Homo sapiens OX=9606 GN=CSTF3 PE=1 SV=1
16	F1M4W7	0.76	35.4	717	0.050	0.042	F1M4W7_RAT Cleavage stimulation factor subunit 3 OS=Rattus norvegicus OX=10116 GN=Cstf3 PE=1 SV=4
17	E9PLP8	0.78	35.0	749	0.050	0.040	E9PLP8_HUMAN Cleavage stimulation factor subunit 3 OS=Homo sapiens OX=9606 GN=CSTF3 PE=1 SV=2
18	Q9VHG5	1.1	33.9	242	0.027	0.066	Q9VHG5_DROME Insulator binding factor 1, isoform A OS=Drosophila melanogaster OX=7227 GN=Ibf1 PE=1 SV=1
19	Q42463	1.2	33.9	224	0.022	0.058	DCL_SOLLC Protein DCL, chloroplastic OS=Solanum lycopersicum OX=4081 GN=DCL PE=2 SV=1
20	Q05022	4.7	32.7	1729	0.027	0.009	RRP5_YEAST rRNA biogenesis protein RRP5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RRP5 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08311 Mad3_BUB1_I	2.9e+02	12.8	Mad3/BUB1 homology region 1
2	PF08424 NRDE-2	0.043	24.5	NRDE-2, necessary for RNA interference
3	PF13428 TPR_14	1.6	20.7	Tetratricopeptide repeat
4	PF08640 U3_assoc_6	1.5e-21	87.4	U3 small nucleolar RNA-associated protein 6

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000261708

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000225298	0.999	U3 small nucleolar RNA-associated protein 18 homolog
2	9606.ENSP00000232888	0.999	U3 small nucleolar RNA-interacting protein 2
3	9606.ENSP00000254803	0.999	Something about silencing protein 10
4	9606.ENSP00000291576	0.999	Periodic tryptophan protein 2 homolog
5	9606.ENSP00000296792	0.999	U3 small nucleolar RNA-associated protein 15 homolog
6	9606.ENSP00000308179	0.999	WD repeat-containing protein 3
7	9606.ENSP00000327179	0.999	U3 small nucleolar RNA-associated protein 4 homolog
8	9606.ENSP00000355541	0.999	HEAT repeat-containing protein 1
9	9606.ENSP00000363642	0.999	Ribosome biogenesis protein BMS1 homolog
10	9606.ENSP00000363746	0.999	WD repeat-containing protein 46
11	9606.ENSP00000423067	0.999	WD repeat-containing protein 36
12	9606.ENSP00000454836	0.999	Transducin beta-like protein 3
13	9606.ENSP00000229214	0.998	KRR1 small subunit processome component homolog
14	9606.ENSP00000244230	0.998	U3 small nucleolar ribonucleoprotein protein MPP10
15	9606.ENSP00000264279	0.998	Nucleolar protein 58
16	9606.ENSP00000297579	0.998	DDB1- and CUL4-associated factor 13
17	9606.ENSP00000297990	0.998	Nucleolar protein 6
18	9606.ENSP00000314193	0.998	WD repeat-containing protein 75
19	9606.ENSP00000328854	0.998	Nucleolar complex protein 4 homolog
20	9606.ENSP00000386134	0.998	Neuroguidin

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0044237	0.993	cellular metabolic process
GO:0044238	0.991	primary metabolic process
GO:1901360	0.985	organic cyclic compound metabolic process
GO:0006807	0.966	nitrogen compound metabolic process
GO:0090304	0.961	nucleic acid metabolic process
GO:0016070	0.934	RNA metabolic process
GO:0010467	0.889	gene expression
GO:0006396	0.840	RNA processing
GO:0032502	0.754	developmental process
GO:0032501	0.749	multicellular organismal process
GO:0065007	0.648	biological regulation
GO:0048856	0.569	anatomical structure development
GO:0071840	0.516	cellular component organization or biogenesis
GO:0007275	0.500	multicellular organism development
GO:0050789	0.488	regulation of biological process
GO:0044085	0.473	cellular component biogenesis
GO:0050794	0.372	regulation of cellular process
GO:0022613	0.318	ribonucleoprotein complex biogenesis
GO:0034660	0.315	ncRNA metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043232	1.000	intracellular non-membrane-bounded organelle
GO:0005654	1.000	nucleoplasm
GO:0005694	0.992	chromosome
GO:0005730	0.990	nucleolus
GO:0005737	0.739	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]